Recombinant Human Glutaredoxin-3(GLRX3)

Code CSB-EP009523HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names GLRX3
Uniprot No. O76003
Research Area Signal Transduction
Alternative Names glrx3; GLRX3_HUMAN; GLRX4; Glutaredoxin 3; Glutaredoxin 4; Glutaredoxin-3; GRX3; GRX4; PICOT; PKC interacting cousin of thioredoxin; PKC theta interacting protein; PKC-interacting cousin of thioredoxin; PKC-theta-interacting protein; PKCq interacting protein; PKCq-interacting protein; Thioredoxin like protein 2; Thioredoxin-like protein 2; TXNL2; TXNL3
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-335aa
Target Protein Sequence AAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 64.3kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins
Gene References into Functions
  1. The findings suggested the vital roles of GLRX3 in OSCC progression through its relationship with EMT progression, and these data also suggest that a strategy of blocking ROS to enhance the activity of GLRX3 knockdown warrants further attention in the treatment of OSCC. PMID: 29397791
  2. GLRX3 might be an oncoprotein in nasopharyngeal carcinoma PMID: 27203742
  3. The Glrx3.BolA is a [2Fe-2S] chaperone complex capable of transferring [2Fe-2S] clusters to apoproteins in human cells. PMID: 27519415
  4. apo GRX3 and apo BOLA2 form a heterotrimeric complex, composed by two BOLA2 molecules and one GRX3 molecule PMID: 26613676
  5. findings provide novel insights into the regulation of Grx3, which is crucial for cell survival against environmental insults PMID: 25975981
  6. These findings provide an advanced view of the functional role of glutaredoxin-3 in iron metabolism. PMID: 26302480
  7. These in vitro studies suggest that human GLRX3 is important for cytosolic Fe-S protein maturation. PMID: 26296460
  8. Data indicate that silencing of Grx3 in HeLa cells decreases the activities of several cytosolic Fe/S proteins, including iron-regulatory protein 1, a major component of posttranscriptional iron regulation. PMID: 23615448
  9. these data raise the possibility that the pro-apoptotic role of PICOT is actively regulated via caspase-3-mediated cleavage. PMID: 23415866
  10. the unusual [2Fe-2S]-bridging Grx-BolA interaction is conserved in higher eukaryotes and may play a role in signaling cellular iron status in humans. PMID: 22309771
  11. investigations into role of Grx3: Grx3-knockdown in HeLa cells leads to significant delay in mitotic exit and a higher percentage of binucleated cells. PMID: 21575136
  12. analysis of primary breast cancer samples demonstrated that enhanced TXNL2 expression correlated with metastasis to the lung and brain and with decreased overall patient survival PMID: 21123948
  13. Demonstrated a differential expression of PICOT in various cell types, with a predominant cytosolic staining of epithelial cells and low or undetectable levels of PICOT in the stroma. PMID: 20498481
  14. The present results show a direct correlation between PICOT expression levels and increased cell growth, both in vitro and in vivo. PMID: 20170406
  15. redox-induced dissociation of the Grx3/PICOT holo complex may be a mechanism of Grx3/PICOT activation in response to reactive oxygen and nitrogen species. PMID: 20226171
  16. Western blot analysis revealed consistent and preferential expression of Glrx3 in lung and colon cancers; results suggest that Glrx3 could take a pivotal role in colon and lung cancer cells during tumorigenesis PMID: 19797004
  17. thioredoxin-like 2 may have a role in colorectal cancer, as it is the antigen for the monoclonal antibody MC3 specific to colorectal cancer PMID: 18528843

Show More

Hide All

Subcellular Location Cytoplasm, cytosol, Cytoplasm, cell cortex, Cytoplasm, myofibril, sarcomere, Z line
Tissue Specificity Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.
Database Links

HGNC: 15987

OMIM: 612754

KEGG: hsa:10539

STRING: 9606.ENSP00000330836

UniGene: Hs.42644

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1