Recombinant Human Glutaredoxin-3(GLRX3)

Code CSB-EP009523HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O76003
Relevance Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator . Crucial regulator of cellular iron homeostasis and hemoglobin maturation. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias PKC-interacting cousin of thioredoxin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Research Area Signal Transduction
Source E.coli
Gene Names GLRX3
Protein Names Recommended name: Glutaredoxin-3 Alternative name(s): PKC-interacting cousin of thioredoxin Short name= PICOT PKC-theta-interacting protein Short name= PKCq-interacting protein Thioredoxin-like protein 2
Expression Region 1-335aa
Tag Info N-terminal GST-tagged
Mol. Weight 64.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins
Subcellular Location Cytoplasm, cytosol, Cytoplasm, cell cortex, Cytoplasm, myofibril, sarcomere, Z line
Tissue Specificity Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.
Database Links

HGNC: 15987

OMIM: 612754

KEGG: hsa:10539

STRING: 9606.ENSP00000330836

UniGene: Hs.42644

Related Products

GLRX3 Antibodies

GLRX3 Antibodies for Homo sapiens (Human)

GLRX3 Antibodies for Human

GLRX3 Proteins

GLRX3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.