Recombinant Human Glutaredoxin-3 (GLRX3)

Code CSB-YP009523HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009523HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP009523HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP009523HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
GLRX3
Uniprot No.
Alternative Names
glrx3; GLRX3_HUMAN; GLRX4; Glutaredoxin 3; Glutaredoxin 4; Glutaredoxin-3; GRX3; GRX4; PICOT; PKC interacting cousin of thioredoxin; PKC theta interacting protein; PKC-interacting cousin of thioredoxin; PKC-theta-interacting protein; PKCq interacting protein; PKCq-interacting protein; Thioredoxin like protein 2; Thioredoxin-like protein 2; TXNL2; TXNL3
Species
Homo sapiens (Human)
Expression Region
1-335aa
Target Protein Sequence
MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins. Acts as a critical negative regulator of cardiac hypertrophy and a positive inotropic regulator. Required for hemoglobin maturation. Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.
Gene References into Functions
  1. The findings suggested the vital roles of GLRX3 in OSCC progression through its relationship with EMT progression, and these data also suggest that a strategy of blocking ROS to enhance the activity of GLRX3 knockdown warrants further attention in the treatment of OSCC. PMID: 29397791
  2. GLRX3 might be an oncoprotein in nasopharyngeal carcinoma PMID: 27203742
  3. The Glrx3.BolA is a [2Fe-2S] chaperone complex capable of transferring [2Fe-2S] clusters to apoproteins in human cells. PMID: 27519415
  4. apo GRX3 and apo BOLA2 form a heterotrimeric complex, composed by two BOLA2 molecules and one GRX3 molecule PMID: 26613676
  5. findings provide novel insights into the regulation of Grx3, which is crucial for cell survival against environmental insults PMID: 25975981
  6. These findings provide an advanced view of the functional role of glutaredoxin-3 in iron metabolism. PMID: 26302480
  7. These in vitro studies suggest that human GLRX3 is important for cytosolic Fe-S protein maturation. PMID: 26296460
  8. Data indicate that silencing of Grx3 in HeLa cells decreases the activities of several cytosolic Fe/S proteins, including iron-regulatory protein 1, a major component of posttranscriptional iron regulation. PMID: 23615448
  9. these data raise the possibility that the pro-apoptotic role of PICOT is actively regulated via caspase-3-mediated cleavage. PMID: 23415866
  10. the unusual [2Fe-2S]-bridging Grx-BolA interaction is conserved in higher eukaryotes and may play a role in signaling cellular iron status in humans. PMID: 22309771
  11. investigations into role of Grx3: Grx3-knockdown in HeLa cells leads to significant delay in mitotic exit and a higher percentage of binucleated cells. PMID: 21575136
  12. analysis of primary breast cancer samples demonstrated that enhanced TXNL2 expression correlated with metastasis to the lung and brain and with decreased overall patient survival PMID: 21123948
  13. Demonstrated a differential expression of PICOT in various cell types, with a predominant cytosolic staining of epithelial cells and low or undetectable levels of PICOT in the stroma. PMID: 20498481
  14. The present results show a direct correlation between PICOT expression levels and increased cell growth, both in vitro and in vivo. PMID: 20170406
  15. redox-induced dissociation of the Grx3/PICOT holo complex may be a mechanism of Grx3/PICOT activation in response to reactive oxygen and nitrogen species. PMID: 20226171
  16. Western blot analysis revealed consistent and preferential expression of Glrx3 in lung and colon cancers; results suggest that Glrx3 could take a pivotal role in colon and lung cancer cells during tumorigenesis PMID: 19797004
  17. thioredoxin-like 2 may have a role in colorectal cancer, as it is the antigen for the monoclonal antibody MC3 specific to colorectal cancer PMID: 18528843

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol. Cytoplasm, cell cortex. Cytoplasm, myofibril, sarcomere, Z line.
Tissue Specificity
Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.
Database Links

HGNC: 15987

OMIM: 612754

KEGG: hsa:10539

STRING: 9606.ENSP00000330836

UniGene: Hs.42644

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1