Recombinant Human Glutathione S-transferase P(GSTP1)

In Stock
Code CSB-YP009989HUb0
Product Type Recombinant Protein
Size US$2474
Uniprot No. P09211
Relevance Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Research Area Metabolism
Source Yeast
Gene Names GSTP1
Protein Names GST class-piGSTP1-1
Expression Region 2-210aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 25.7 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Subcellular Location Cytoplasm, Mitochondrion, Nucleus
Protein Families GST superfamily, Pi family
Database Links

HGNC: 4638

OMIM: 134660

KEGG: hsa:2950

STRING: 9606.ENSP00000381607

UniGene: Hs.523836

Pathway Target Therapy

Related Products

GSTP1 Antibodies

GSTP1 Antibodies for Homo sapiens (Human)

GSTP1 Antibodies for Human

GSTP1 Proteins

GSTP1 Proteins for Homo sapiens (Human)

GSTP1 ELISA Kit

GSTP1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.