Recombinant Human Glutathione S-transferase P(GSTP1)

In Stock
Code CSB-YP009989HUb0
Size US$2474
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names GSTP1
Uniprot No. P09211
Research Area Metabolism
Alternative Names Deafness; Deafness X-linked 7; DFN7; FAEES3; Fatty Acid Ethyl Ester Synthase III ; Glutathione S Transferase 3; Glutathione S Transferase Pi; Glutathione S-transferase P; Glutathione S-transferase pi 1; GST class-pi; GST3; GSTP; Gstp1; GSTP1-1; GSTP1_HUMAN; PI; X linked 7
Species Homo sapiens (Human)
Source Yeast
Expression Region 2-210aa
Target Protein Sequence PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 25.7 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Gene References into Functions
  1. data suggest that GSTP1 expression is not associated with bladder cancer (BC) development, limiting its use as a biomarker for BC management in Morocco. Moreover, difference in GSTP1 expression among BC cases is not due to GSTP1 promoter methylation. PMID: 30043549
  2. Methylation GSTP1 is associated with Breast Cancer. PMID: 30049201
  3. Prenatal fine particulate exposure in late pregnancy was associated with impaired childhood lung function and hypermethylation of GSTP1 in nasal epithelium. PMID: 29703190
  4. The study revealed association of GSTP1 I105V with Infectious Endocarditis, but the disease proved unrelated to GSTP1 A114V polymorphism. PMID: 30289676
  5. The results of this meta-analysis suggest that GSTP1 hypermethylation induces the inactivation of GSTP1 gene, plays an important role in hepatocarcinogenesis, and is associated with an increased risk of HCC. PMID: 29970711
  6. The expression levels of LRP and GSTP1 in primary epithelial ovarian cancer were the highest, followed by borderline adenoma tissues, and lowest levels in benign tumor tissues. The difference between resistant gene negative-expression and positive-expression of chemotherapy efficiency, disease free survival time, and recurrence time were statistically significant. PMID: 30313031
  7. polymorphisms do not have any large effect on risk of cutaneous malignant melanoma [meta-analysis] PMID: 27304781
  8. Design and synthesis of 2-substituted-5-(4-trifluoromethylphenyl-sulphonamido)benzoxazole derivatives as human GST P1-1 inhibitors. PMID: 28503938
  9. The present study findings provide the insights that miR133b reduces cisplatin resistance and its overexpression contributes to the suppression of the malignant growth and aggressiveness of cisplatinresistant nonsmall cell lung cancer cells by targeting GSTP1. PMID: 29328427
  10. Through translational prospective study, the GSTP1 Ile105Val polymorphism emerges as prognostic marker in de novo large B-cell lymphoma patients. PMID: 28452985
  11. GSTP1 polymorphism is associated with Cervical Cancer in Human Papilloma Virus Infected patients. PMID: 29479986
  12. GSTP1 Ile105Val was associated with increased lung function, reduced risk for lung cancer and tobacco-related cancer, and reduced all-cause mortality in the general population. PMID: 28739440
  13. the recessive model of GSTP1 g.313A>G is the best fit inheritance model to predict the susceptible gene effect (OR: 2.3, 95% CI: 1.11-4.92, P = 0.020). In conclusion, statistically significant associations of GSTP1 g.313A>G (A/G, G/G) and g.341C>T (C/T) genotypes with coronary artery disease were observed. PMID: 29321351
  14. The GSTP1 AG genotype of Alzheimer's disease was significantly lower (p = 0.005; OR = 0.57, 95% CI: 0.38-0.84) in the patients (41.1%) than the control group (56.5%). PMID: 29072550
  15. Study provides evidence that high expression of CLDN6 confers chemoresistance on breast cancer which is mediated by GSTP1, the activity of which is regulated by p53. PMID: 29116019
  16. Patients with CYP2C19*2 were at increased risk and CYP2C19*2, CYP3A5*3 and GSTP1 have synergistic influence on CYC failure. PMID: 28976264
  17. CML patients with carriage of heterozygous and homozygous variant genotypes of GSTP1 Ile105Val and GSTT1 null, have a higher risk for development of resistance to IM. PMID: 28947711
  18. the GSTP1 Ile105Val polymorphism is not associated with the development of gynecological cancer (meta-analysis). PMID: 28410197
  19. DNA sequencing was performed for six single-nucleotide polymorphisms in the GSTP1, RAD51, XRCC1 and XRCC3 genes in BC patients and the control group. Two variants in the 5'-UTR of the XRCC3 and RAD51 genes showed a significant association with susceptibility to breast cancer. Additionally, authors reported 2 mutations in intron 7 of the XRCC3 gene. PMID: 28315507
  20. The SNPs in CYP1A1, GSTP1 and XRCC1 genes did not show significant association with complete remission (CR) rate, overall survival (OS) or event free survival (EFS). However, XRCC1 Arg194Trp SNP was associated with higher drug toxicity; carriers of variant genotypes (CT and TT) had a significantly higher frequency of myelosuppression compared to those with the wild CC genotype PMID: 28844589
  21. There were significant differences in GSTP1 (rs1138272 and rs1695) genotype or allele frequencies between the infertile and fertile groups and synergy effects of GSTP1 and NAT2 polymorphisms might lead to significant increase of infertility risk. PMID: 29505746
  22. Significantly higher frequency of the GSTP1 polymorphism was observed in Extremely Low Birth Weight Preterm Infants with Bronchopulmonary Dysplasia. PMID: 28081574
  23. Polymorphisms of GSTP1 rs1695 and ABCC2 rs717620 can be used to predict the outcomes of Uygur patients with advanced NSCLC who have received platinum-based chemotherapy. Kaplan-Meier survival analysis indicated that survival with GSTP1 AG+ GG was significantly longer than in patients with AA gene (P<0.05), and survival with ABCC2 CT + TT was significantly longer than in patients with CC gene. PMID: 28442702
  24. GSTpi inhibited p38MAPK phosphorylation by directly binding p38 and influenced downstream substrate HSP27-induced actin remodeling. PMID: 29402793
  25. the GSTP1 gene polymorphism may play a significant role in the increase of susceptibility of obesity and contribute to identify the cardiovascular risk in young adults. PMID: 28561194
  26. These observations could support the hypothesis that the GSTP1 G allele may improve exercise performance by better elimination of exercise-induced reactive oxygen species. PMID: 28062686
  27. This study demonstrates that the GSTP1*B and *C allelic variants may be considered a candidate gene for AD[Alzheimer disease]. It can be suggested that although CYP2D6*4 polymorphism is not a risk of AD[Alzheimer disease], the CYP2D6*4 and GSTP1 polymorphism may interact with beta-HCH, dieldrin, and copper to influence the risk of AD [Alzheimer disease]. PMID: 24584466
  28. Comparing to controls, significant association with asthma was observed for GSTP1 rs1695 AA genotype PMID: 27561723
  29. Peroxidase activity was markedly reduced by mutation at either of the Leu sites and was essentially abolished by the double mutation, while PLA2 activity was unaffected. Decreased peroxidase activity following mutation of the interfacial leucines presumably is mediated via impaired heterodimerization of Prdx6 with piGST that is required for reduction and re-activation of the oxidized enzyme. PMID: 26891882
  30. Epigenetic alteration of GSTP1 regulates its expression in lens epithelial and cortical tissues. These changes likely contribute to the pathogenesis of ARNC. PMID: 27348130
  31. GSTP1 rs1695 polymorphism was associated with higher susceptibility to the development of cervical lesions in HR-HPV-infected women. PMID: 28829907
  32. We report that patients who were homozygous for the ancestral allele of the GTSP1 SNP rs1695 had a greater decline in lung function at 1 year after stem cell transplantation compared to those who had at least one minor allele of the GTSP1 SNP rs1695. PMID: 28152281
  33. Single nucleotide polymorphisms in EPHX1, GSTP1, SERPINE2, and TGFB1 contributing to the quantitative traits of chronic obstructive pulmonary disease in Chinese Han population. PMID: 27193053
  34. polymorphisms of the GSTM1 del and GSTT1 del genes were analysed by multiplex PCR. Genotyping of the polymorphic variants in the GSTP1 (A313G, T341C) gene was performed using Real-time PCR with competing TaqMan probes complementary to the polymorphic DNA sites PMID: 28770368
  35. genetic or pharmacological inactivation of GSTP1 impairs cell survival and tumorigenesis in TNBC cells; GSTP1 inhibitors may be a novel therapeutic strategy for combatting TNBCs through impairing key cancer metabolism and signaling pathways PMID: 27185638
  36. Wild-type GSTP1 allele when combined with LOH/MSI in steroid metabolism genes may play a role in ER and/or PR negative breast cancers. PMID: 28692125
  37. meta-analysis suggests that the GSTP1 Ile105Val polymorphism might not contribute to risk of male infertility PMID: 28397729
  38. GTSP1 was expressed in tumors of HNSCC patients regardless of smoking, drinking or HPV infection status. GTSP1 expression was higher in the non-tumor margins of smoker/drinker group. PMID: 28817620
  39. there is a significant implication of the SNP rs1695 within the GSTP1 gene with ALL of Jordanian Arab children. PMID: 27299594
  40. RASSF10 functions as a tumor suppressor by cooperating with GSTP1 to deregulate JNK/c-Jun/AP-1 pathway in gastric cancer PMID: 26279301
  41. GSTP1 gene polymorphisms were not associated with the acquisition of hepatotoxicity in HIV patients treated with antiretroviral therapy. PMID: 26667829
  42. Individuals carrying theGSTP1 Ile-Ile or XRCC1399 Arg-Arg genotypes showed greater DNA damage than observed for other alleles. PMID: 28622826
  43. the significance of GSTP1 polymorphisms on Chronic myeloid leukemia susceptibility and response to tyrosine kinase inhibitors in the Argentinean population PMID: 27454607
  44. Meta-analysis found that GSTP1 showed a trend toward a worse prognosis in overall survival in patients with breast cancer. PMID: 28700487
  45. This is the first study to suggest that GSTP1 genotyping can be an important tool for identifying patients who are susceptible to Anti-tuberculosis drug-induced hepatotoxicity. PMID: 27281183
  46. GSTP1-1 can detoxify arsenic-based drugs by sequestration at the active site and at the dimer interface, in situations where there is a plentiful supply of GSH, and at the reactive cysteines in conditions of low GSH. PMID: 27863446
  47. Patients carrying at least one GSTP1 Val allele achieved remission in a shorter time period than patients with GSTP1 Ile/Ile genotype. PMID: 28039708
  48. Our study indicates that GSTP1 shows aberrant methylation pattern in the breast cancer with the consequent loss in the protein expression. PMID: 28443466
  49. Overexpression of GSTP1 is associated with pancreatic Cancer. PMID: 27872191
  50. The rs614080 SNP near the GSTP1 gene was significantly associated with body mass index and GSTP1 expression levels in the Mexican population. PMID: 27881840
  51. Results show that GSTP potentiates S-glutathionylation of Keap1, which leads to Nrf2 activation and subsequently increases expression of GSTP. This positive feedback regulatory loop represents a novel mechanism by which GSTP elicits antioxidant protection in the brain. PMID: 27086966
  52. Study provides evidence that GSTP1 gene polymorphism has an impact on the perioperative serum alpha-GST concentration in patients undergoing sevoflurane anaesthesia which is an indicator for liver hepatotoxicity. A similar association, although not statistically significant exists between GSTA1 gene variants and perioperative serum alpha-GST level. PMID: 27179909
  53. Study could not find a significant association between GSTM1, GSTP1 and GSTT1 genotypes distribution and attention deficit and hyperactivity disorder. However, significant associations were observed in the subtype analyses for GSTP1 and GSTT1 polymorphisms. PMID: 27060407
  54. In this study we determined the relationship between the ADRB2 Arg16Gly polymorphism and GSTP1 polymorphisms, involved in bronchodilator response and oxidative stress, respectively, with susceptibility to asthma. GSTP1 Ile105Val polymorphism may be linked to the severeness of airway dysfunction. PMID: 27385593
  55. association between polymorphisms in three glutathione S-transferase genes (GSTP1, GSTM1, and GSTT1) and treatment outcome for advanced non-small cell lung cancer. Genotypes of GSTP1 were associated w/ lower risk of disease progression compared with the IIe/IIe genotype. No significant association was observed between GSTM1 and GSTT1 polymorphisms and progression-free survival and overall survival in the NSCLC patients. PMID: 27525853
  56. Mutant genotype of GSTP1 rs1695 seems to be a genetic risk factor in univariate analyses, although not confirmed by multivariate analyses. PMID: 27729156
  57. GSTP1, APC and RASSF1 gene methylation in prostate cancer samples: comparative analysis of MS-HRM method and Infinium HumanMethylation450 BeadChip beadchiparray diagnostic value PMID: 28026816
  58. The results suggest that the GSTP1 gene polymorphism is associated with an increased risk of osteosarcoma. PMID: 27525908
  59. The meta-analysis indicated that the GSTP1 rs1695 A>G polymorphism did not contribute to the susceptibility of breast cancer when the overall population was considered. However, our study indicated that the GSTP1 rs1695 A>G polymorphism was correlated with elevated BC risk in Asian women. PMID: 27323180
  60. This study shows that the effect of Ile105Val mutation on GSTP1 binding pattern was dependent on the substrate and it instigated differences in interaction and energy contour with drug substrates. PMID: 28153749
  61. The GSTP1 341C/T polymorphism may contribute to lung cancer risk. [meta-analysis] PMID: 27525882
  62. GSTP1 is methylated and underexpressed in prostate cancer tissue. PMID: 27594734
  63. our findings provide supporting evidence for a contributory role of GSTP1 rs4147581 polymorphism in predicting the prognosis of HCC. PMID: 26260272
  64. we suggest that GSTP1 Ile105Val and XRCC1 Arg399Gln polymorphisms could influence the response to chemotherapy and sur-vival of advanced non-small cell lung carcinoma. PMID: 27323109
  65. Presence of Helicobacter pylori with CagA genotype showed significant individual effect with GSTT1 polymorphism as well as strong synergistic effect in gastric cancer risk. PMID: 27006283
  66. GSTP1 Ile105Val polymorphism was associated with tumor response, progression-free survival, and overall survival in gastric and colorectal cancers after chemotherapy (meta-analysis). PMID: 27154175
  67. Val allele of GSTP1-Ile105Val polymorphism may be associated with worse functional and clinical status in carpal tunnel syndrome PMID: 25566970
  68. GSTP1 genetic polymorphism is not associated with ovarian cancer. PMID: 25124586
  69. patients who carry the wild type genotype or only one polymorphism for either NQO1 or GSTP1 gene have possibly a better clinical outcome after the natalizumab therapy. PMID: 27993870
  70. Study indicates that GSTP1 Val allele and its variant genotype may be associated with higher risk for development of type 2 diabetes mellitus. PMID: 27368697
  71. Glutathione S-transferase pi 1 polymorphisms did not modify the association between traffic-related air pollution exposure during the first year of life and current hay fever at any time point. PMID: 27043549
  72. Nrf2 is now recognized to be a component of GSTP interactome..[review] PMID: 26922696
  73. The A/A genotype of the GSTP1 polymorphism is associated with febrile neutropenia in breast cancer. PMID: 25008867
  74. GSTP1 genetic variation may be associated with breast cancer in Pakistani population. PMID: 26545608
  75. cells was consistent with previous studies showing a constitutive expression of their GSTP1. Thus, while both ginger phenylpropanoids and quercetin have the property of increasing the level of Nrf2 both in HaCaT and in BJ cells, their effects on its downstream signalling were mediated only in BJ cells. PMID: 26942188
  76. the GSTP1 Ile105Val and XRCC1 Arg194Trp were associated with better response to chemotherapy and longer survival of advanced non-small cell lung cancer PMID: 26823821
  77. GSTP1 hypermethylation on a negative biopsy is associated with the risk of prostate cancer on a rebiopsy, especially of high-grade prostate cancer. PMID: 26475336
  78. GSTP1 polymorphism was correlated with better response to chemotherapy and lower risk of death in advanced non-small cell lung cancer patients. PMID: 26722539
  79. In the present study, GSTP1Ile105Val (rs1695) polymorphism was related to breast cancer susceptibility or phenotype PMID: 26407578
  80. GG genotype of GSTP1 IIe105Val was significantly associated with better response to chemotherapy and breast cancer prognosis. PMID: 26681014
  81. that 6,7-dihydroxy-3-arylcoumarins may represent a new promising scaffold to discover potent GSTP1 inhibitors. PMID: 26205366
  82. GSTP1 A114V but not I105V variant increases the risk of motor neuron disease, and combined GSTP1 polymorphisms in codon 105 and 114 may result in lower protection of against the toxicity of electrophilic compounds, organic and inorganic hydroperoxides PMID: 26295823
  83. GSTP1 A313G gene polymorphism might influence the response to cisplatin-based chemotherapy and affect the clinical outcome of advanced non-small cell lung cancer. PMID: 26097600
  84. Results indicated that GSTP1 promoter methylation probably plays an important role in breast carcinogenesis, which could serve as an effective biomarker for the diagnosis and monitor of breast cancer. PMID: 26585467
  85. GSTP1 hypermethylation was associated with DNMT1, DNMT3a overexpression and oxidative stress in patients with HBeAg-positive chronic hepatitis b. PMID: 26725685
  86. The non-wild-type GSTP1 polymorphism was not associated with clinical manifestations of SCD PMID: 25880856
  87. GSTP1 represents a new molecular biomarker which can aid in early detection of PCa and be used to discriminate between benign and malignant prostatic lesions from body fluids by noninvasive methods. PMID: 27468582
  88. This meta-analysis suggests that GSTP1 Ile105Val polymorphism may increase the risk of lung cancer in the Chinese population. PMID: 26458582
  89. Homozygous variant of GSTP1 polymorphism was found in 13 patients, heterozygous variant in 15 patients and Val/Val homozygous variant in 2 patients. PMID: 26158735
  90. our study reveals the novel role of GSTP1 in regulation of iNOS by affecting S-nitrosylation, dimerization, and stability. PMID: 26361746
  91. The GSTP1 gene variant rs1695 is not associated with an increased risk of multiple sclerosis. PMID: 25531394
  92. GSTP1 and GSTO1 polymorphisms are associated with epirubicin treatment outcomes as well as with epirubicin-related toxicity. PMID: 26354850
  93. Incidence of (Val/Val) genotype in colorectal cancer cases was three folds higher than controls. PMID: 26994385
  94. GSTP1 gene polymorphisms may contribute to the development of T2DM and are not associated with susceptibility to diabetic neuropathy. PMID: 26435566
  95. GSTT1 and GSTP1 polymorphisms did not show any significant association with lung cancer PMID: 26529288
  96. GSTP1 promoter methylation is associated with the risk of hepatocellular carcinoma. PMID: 25853848
  97. MicroRNA-133b may reduce ovarian cancer drug resistance by silencing the expression of the drug-resistance-related proteins, GST-pi and MDR1. PMID: 26396496
  98. Children with AA at nucleotide 1695 in GSTP1 who had tobacco smoke exposure and low vitamin A intake have an increased risk of asthma. Smoke exposure and low vitamin A intake did not increase odds of asthma diagnosis in children with AG or GG genotypes. PMID: 26490046
  99. GSTP1 promoter hypermethylation is associated with Prostate Cancer. PMID: 25753984
  100. the GSTP1 rs1695 and XRCC1 rs25487 polymorphisms might affect the clinical outcome of patients with advanced non-small cell lung cancer receiving cisplatin-based chemotherapy. PMID: 26345972

Show More

Hide All

Subcellular Location Cytoplasm, Mitochondrion, Nucleus
Protein Families GST superfamily, Pi family
Database Links

HGNC: 4638

OMIM: 134660

KEGG: hsa:2950

STRING: 9606.ENSP00000381607

UniGene: Hs.523836

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1