Recombinant Human Glutathione S-transferase P (GSTP1)

In Stock
Code CSB-EP009989HUe0
Abbreviation Recombinant Human GSTP1 protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
Deafness; Deafness X-linked 7; DFN7; FAEES3; Fatty Acid Ethyl Ester Synthase III ; Glutathione S Transferase 3; Glutathione S Transferase Pi; Glutathione S-transferase P; Glutathione S-transferase pi 1; GST class-pi; GST3; GSTP; Gstp1; GSTP1-1; GSTP1_HUMAN; PI; X linked 7
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-210aa
Target Protein Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding this proteins, could they be purchased in PBS 1X?

A:
Thanks for your inquir. If you want the protein in PBS buffer, without glycerol, we recommend the lyophilized format. The lead time will be 3 working days longer. Because the glycerol can protect the protein in a stable status.

Target Background

Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Gene References into Functions
  1. data suggest that GSTP1 expression is not associated with bladder cancer (BC) development, limiting its use as a biomarker for BC management in Morocco. Moreover, difference in GSTP1 expression among BC cases is not due to GSTP1 promoter methylation. PMID: 30043549
  2. Methylation GSTP1 is associated with Breast Cancer. PMID: 30049201
  3. Prenatal fine particulate exposure in late pregnancy was associated with impaired childhood lung function and hypermethylation of GSTP1 in nasal epithelium. PMID: 29703190
  4. The study revealed association of GSTP1 I105V with Infectious Endocarditis, but the disease proved unrelated to GSTP1 A114V polymorphism. PMID: 30289676
  5. The results of this meta-analysis suggest that GSTP1 hypermethylation induces the inactivation of GSTP1 gene, plays an important role in hepatocarcinogenesis, and is associated with an increased risk of HCC. PMID: 29970711
  6. The expression levels of LRP and GSTP1 in primary epithelial ovarian cancer were the highest, followed by borderline adenoma tissues, and lowest levels in benign tumor tissues. The difference between resistant gene negative-expression and positive-expression of chemotherapy efficiency, disease free survival time, and recurrence time were statistically significant. PMID: 30313031
  7. polymorphisms do not have any large effect on risk of cutaneous malignant melanoma [meta-analysis] PMID: 27304781
  8. Design and synthesis of 2-substituted-5-(4-trifluoromethylphenyl-sulphonamido)benzoxazole derivatives as human GST P1-1 inhibitors. PMID: 28503938
  9. The present study findings provide the insights that miR133b reduces cisplatin resistance and its overexpression contributes to the suppression of the malignant growth and aggressiveness of cisplatinresistant nonsmall cell lung cancer cells by targeting GSTP1. PMID: 29328427
  10. Through translational prospective study, the GSTP1 Ile105Val polymorphism emerges as prognostic marker in de novo large B-cell lymphoma patients. PMID: 28452985
  11. GSTP1 polymorphism is associated with Cervical Cancer in Human Papilloma Virus Infected patients. PMID: 29479986
  12. GSTP1 Ile105Val was associated with increased lung function, reduced risk for lung cancer and tobacco-related cancer, and reduced all-cause mortality in the general population. PMID: 28739440
  13. the recessive model of GSTP1 g.313A>G is the best fit inheritance model to predict the susceptible gene effect (OR: 2.3, 95% CI: 1.11-4.92, P = 0.020). In conclusion, statistically significant associations of GSTP1 g.313A>G (A/G, G/G) and g.341C>T (C/T) genotypes with coronary artery disease were observed. PMID: 29321351
  14. The GSTP1 AG genotype of Alzheimer's disease was significantly lower (p = 0.005; OR = 0.57, 95% CI: 0.38-0.84) in the patients (41.1%) than the control group (56.5%). PMID: 29072550
  15. Study provides evidence that high expression of CLDN6 confers chemoresistance on breast cancer which is mediated by GSTP1, the activity of which is regulated by p53. PMID: 29116019
  16. Patients with CYP2C19*2 were at increased risk and CYP2C19*2, CYP3A5*3 and GSTP1 have synergistic influence on CYC failure. PMID: 28976264
  17. CML patients with carriage of heterozygous and homozygous variant genotypes of GSTP1 Ile105Val and GSTT1 null, have a higher risk for development of resistance to IM. PMID: 28947711
  18. the GSTP1 Ile105Val polymorphism is not associated with the development of gynecological cancer (meta-analysis). PMID: 28410197
  19. DNA sequencing was performed for six single-nucleotide polymorphisms in the GSTP1, RAD51, XRCC1 and XRCC3 genes in BC patients and the control group. Two variants in the 5'-UTR of the XRCC3 and RAD51 genes showed a significant association with susceptibility to breast cancer. Additionally, authors reported 2 mutations in intron 7 of the XRCC3 gene. PMID: 28315507
  20. The SNPs in CYP1A1, GSTP1 and XRCC1 genes did not show significant association with complete remission (CR) rate, overall survival (OS) or event free survival (EFS). However, XRCC1 Arg194Trp SNP was associated with higher drug toxicity; carriers of variant genotypes (CT and TT) had a significantly higher frequency of myelosuppression compared to those with the wild CC genotype PMID: 28844589
  21. There were significant differences in GSTP1 (rs1138272 and rs1695) genotype or allele frequencies between the infertile and fertile groups and synergy effects of GSTP1 and NAT2 polymorphisms might lead to significant increase of infertility risk. PMID: 29505746
  22. Significantly higher frequency of the GSTP1 polymorphism was observed in Extremely Low Birth Weight Preterm Infants with Bronchopulmonary Dysplasia. PMID: 28081574
  23. Polymorphisms of GSTP1 rs1695 and ABCC2 rs717620 can be used to predict the outcomes of Uygur patients with advanced NSCLC who have received platinum-based chemotherapy. Kaplan-Meier survival analysis indicated that survival with GSTP1 AG+ GG was significantly longer than in patients with AA gene (P<0.05), and survival with ABCC2 CT + TT was significantly longer than in patients with CC gene. PMID: 28442702
  24. GSTpi inhibited p38MAPK phosphorylation by directly binding p38 and influenced downstream substrate HSP27-induced actin remodeling. PMID: 29402793
  25. the GSTP1 gene polymorphism may play a significant role in the increase of susceptibility of obesity and contribute to identify the cardiovascular risk in young adults. PMID: 28561194
  26. These observations could support the hypothesis that the GSTP1 G allele may improve exercise performance by better elimination of exercise-induced reactive oxygen species. PMID: 28062686
  27. This study demonstrates that the GSTP1*B and *C allelic variants may be considered a candidate gene for AD[Alzheimer disease]. It can be suggested that although CYP2D6*4 polymorphism is not a risk of AD[Alzheimer disease], the CYP2D6*4 and GSTP1 polymorphism may interact with beta-HCH, dieldrin, and copper to influence the risk of AD [Alzheimer disease]. PMID: 24584466
  28. Comparing to controls, significant association with asthma was observed for GSTP1 rs1695 AA genotype PMID: 27561723
  29. Peroxidase activity was markedly reduced by mutation at either of the Leu sites and was essentially abolished by the double mutation, while PLA2 activity was unaffected. Decreased peroxidase activity following mutation of the interfacial leucines presumably is mediated via impaired heterodimerization of Prdx6 with piGST that is required for reduction and re-activation of the oxidized enzyme. PMID: 26891882
  30. Epigenetic alteration of GSTP1 regulates its expression in lens epithelial and cortical tissues. These changes likely contribute to the pathogenesis of ARNC. PMID: 27348130
  31. GSTP1 rs1695 polymorphism was associated with higher susceptibility to the development of cervical lesions in HR-HPV-infected women. PMID: 28829907
  32. We report that patients who were homozygous for the ancestral allele of the GTSP1 SNP rs1695 had a greater decline in lung function at 1 year after stem cell transplantation compared to those who had at least one minor allele of the GTSP1 SNP rs1695. PMID: 28152281
  33. Single nucleotide polymorphisms in EPHX1, GSTP1, SERPINE2, and TGFB1 contributing to the quantitative traits of chronic obstructive pulmonary disease in Chinese Han population. PMID: 27193053
  34. polymorphisms of the GSTM1 del and GSTT1 del genes were analysed by multiplex PCR. Genotyping of the polymorphic variants in the GSTP1 (A313G, T341C) gene was performed using Real-time PCR with competing TaqMan probes complementary to the polymorphic DNA sites PMID: 28770368
  35. genetic or pharmacological inactivation of GSTP1 impairs cell survival and tumorigenesis in TNBC cells; GSTP1 inhibitors may be a novel therapeutic strategy for combatting TNBCs through impairing key cancer metabolism and signaling pathways PMID: 27185638
  36. Wild-type GSTP1 allele when combined with LOH/MSI in steroid metabolism genes may play a role in ER and/or PR negative breast cancers. PMID: 28692125
  37. meta-analysis suggests that the GSTP1 Ile105Val polymorphism might not contribute to risk of male infertility PMID: 28397729
  38. GTSP1 was expressed in tumors of HNSCC patients regardless of smoking, drinking or HPV infection status. GTSP1 expression was higher in the non-tumor margins of smoker/drinker group. PMID: 28817620
  39. there is a significant implication of the SNP rs1695 within the GSTP1 gene with ALL of Jordanian Arab children. PMID: 27299594
  40. RASSF10 functions as a tumor suppressor by cooperating with GSTP1 to deregulate JNK/c-Jun/AP-1 pathway in gastric cancer PMID: 26279301
  41. GSTP1 gene polymorphisms were not associated with the acquisition of hepatotoxicity in HIV patients treated with antiretroviral therapy. PMID: 26667829
  42. Individuals carrying theGSTP1 Ile-Ile or XRCC1399 Arg-Arg genotypes showed greater DNA damage than observed for other alleles. PMID: 28622826
  43. the significance of GSTP1 polymorphisms on Chronic myeloid leukemia susceptibility and response to tyrosine kinase inhibitors in the Argentinean population PMID: 27454607
  44. Meta-analysis found that GSTP1 showed a trend toward a worse prognosis in overall survival in patients with breast cancer. PMID: 28700487
  45. This is the first study to suggest that GSTP1 genotyping can be an important tool for identifying patients who are susceptible to Anti-tuberculosis drug-induced hepatotoxicity. PMID: 27281183
  46. GSTP1-1 can detoxify arsenic-based drugs by sequestration at the active site and at the dimer interface, in situations where there is a plentiful supply of GSH, and at the reactive cysteines in conditions of low GSH. PMID: 27863446
  47. Patients carrying at least one GSTP1 Val allele achieved remission in a shorter time period than patients with GSTP1 Ile/Ile genotype. PMID: 28039708
  48. Our study indicates that GSTP1 shows aberrant methylation pattern in the breast cancer with the consequent loss in the protein expression. PMID: 28443466
  49. Overexpression of GSTP1 is associated with pancreatic Cancer. PMID: 27872191
  50. The rs614080 SNP near the GSTP1 gene was significantly associated with body mass index and GSTP1 expression levels in the Mexican population. PMID: 27881840

Show More

Hide All

Subcellular Location
Cytoplasm. Mitochondrion. Nucleus. Note=The 83 N-terminal amino acids function as un uncleaved transit peptide, and arginine residues within it are crucial for mitochondrial localization.
Protein Families
GST superfamily, Pi family
Database Links

HGNC: 4638

OMIM: 134660

KEGG: hsa:2950

STRING: 9606.ENSP00000381607

UniGene: Hs.523836

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*