Recombinant Human Group 10 secretory phospholipase A2 (PLA2G10)

In Stock
Code CSB-EP018085HU
Abbreviation Recombinant Human PLA2G10 protein
MSDS
Size $256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
43-165aa
Target Protein Sequence
GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Producing recombinant human Group 10 secretory phospholipase A2 (PLA2G10) in E. coli starts with co-cloning the target gene into an expression vector with an N-terminal 10xHis-GST-tag and C-terminal Myc-tag gene, which is introduced into E. coli cells. The target gene corresponds to the 43-165aa of human PLA2G10. These cells are cultured and induced for protein expression. The cells are lysed to release the protein, which is purified using affinity chromatography. Protein purity is checked by SDS-PAGE, reaching up to 85%.

Human PLA2G10 is a secretory phospholipase that hydrolyzes phospholipids, exhibiting a preference for polyunsaturated fatty acids (PUFAs) such as eicosapentaenoic acid (EPA), docosapentaenoic acid (DPA), and arachidonic acid (AA) [1]. This enzyme is expressed in male reproductive organs and/or sperm, indicating its involvement in reproductive processes [2]. PLA2G10 is associated with cancer progression by impairing T-cell infiltration, thereby dampening immunity in cold tumors [3].

Furthermore, human PLA2G10 is involved in immune responses, inflammation, and allergic conditions. PLA2G10 is linked to the production of pro-inflammatory cytokines such as TNF-α and IL-6 from human lung macrophages [4]. In asthma, PLA2G10 expression is notably higher in epithelial cells compared to other airway cells, suggesting a potential role in asthma pathogenesis [5]. The absence of PLA2G10 is related to attenuation of airway phenotypes and inflammatory markers in asthma models [6].

References:
[1] S. Tokuoka, Y. Kita, M. Sato, T. Shimizu, Y. Yatomi, & Y. Oda, Development of tandem mass tag labeling method for lipid molecules containing carboxy and phosphate groups, and their stability in human serum, Metabolites, vol. 11, no. 1, p. 19, 2020. https://doi.org/10.3390/metabo11010019
[2] T. Yamane, T. Shimizu, K. Takahashi-Niki, Y. Takekoshi, S. Iguchi‐Ariga, & H. Ariga, Deficiency of spermatogenesis and reduced expression of spermatogenesis-related genes in prefoldin 5-mutant mice, Biochemistry and Biophysics Reports, vol. 1, p. 52-61, 2015. https://doi.org/10.1016/j.bbrep.2015.03.005
[3] T. Zhang, Up-regulated pla2g10 in cancer impairs t cell infiltration to dampen immunity, Science Immunology, vol. 9, no. 94, 2024. https://doi.org/10.1126/sciimmunol.adh2334
[4] A. Igarashi, Y. Shibata, K. Yamauchi, D. Osaka, N. Takabatake, S. Abeet al., Gly80ser polymorphism of phospholipase a2-iid is associated with cytokine inducibility in a549 cells, Respiration, vol. 78, no. 3, p. 312-321, 2009. https://doi.org/10.1159/000213243
[5] T. Hallstrand, Y. Lü, W. Altemeier, C. Appel, B. Johnson, C. Frevertet al., Regulation and function of epithelial secreted phospholipase a2 group x in asthma, American Journal of Respiratory and Critical Care Medicine, vol. 188, no. 1, p. 42-50, 2013. https://doi.org/10.1164/rccm.201301-0084oc
[6] R. Lamb, Deadly h7n9 influenza virus: a pandemic in the making or a warning lesson?, American Journal of Respiratory and Critical Care Medicine, vol. 188, no. 1, p. 1-2, 2013. https://doi.org/10.1164/rccm.201305-0914ed

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids with preference for phosphatidylcholines and phosphatidylglycerols over phosphatidylethanolamines. Preferentially releases sn-2 omega-6 and omega-3 polyunsaturated fatty acyl (PUFA) chains over saturated fatty acyls. Contributes to phospholipid remodeling of very low-density lipoprotein (VLDL), low-density lipoprotein (LDL) and high-density lipoprotein (HDL) particles. Hydrolyzes LDL phospholipids releasing unsaturated fatty acids that regulate macrophage differentiation toward foam cells. Efficiently hydrolyzes and inactivates platelet activating factor (PAF), a potent lipid mediator present in oxidized LDL. May act in an autocrine and paracrine manner. Secreted by lung epithelium, targets membrane phospholipids of infiltrating eosinophils, releasing arachidonate and boosting eicosanoid and cysteinyl leukotriene synthesis involved in airway inflammatory response. Secreted by gut epithelium, hydrolyzes dietary and biliary phosphatidylcholines in the gastrointestinal lumen. Plays a stem cell regulator role in colon epithelium. Within intracellular compartment, mediates Paneth-like cell differentiation and its stem cell supporting functions by inhibiting the Wnt signaling pathway in intestinal stem cell (ISC). Secreted in the intestinal lumen upon inflammation, acts in an autocrine way and promotes prostaglandin E2 synthesis that stimulates Wnt signaling pathway in ISCs and tissue regeneration. May participate in hair follicle morphogenesis by regulating phosphatidylethanolamines metabolism at the outermost epithelial layer and facilitating melanin synthesis. By releasing lysophosphatidylcholines (LPCs) at sperm acrosome, controls sperm cell capacitation, acrosome reaction and overall fertility. May promote neurite outgrowth in neuron fibers involved in nociception. Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of phosphatidylglycerols and phosphatidylethanolamines, which are major components of membrane phospholipids in bacteria. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane. In pulmonary epithelium, may contribute to host defense response against adenoviral infection. Prevents adenovirus entry into host cells by hydrolyzing host cell plasma membrane, releasing C16:0 LPCs that inhibit virus-mediated membrane fusion and viral infection. Likely prevents adenoviral entry into the endosomes of host cells. May play a role in maturation and activation of innate immune cells including macrophages, group 2 innate lymphoid cells and mast cells.
Gene References into Functions
  1. This report provides the first demonstration that Phosphatidylcholine-Isoprostanes are readily hydrolyzed by group IIA, V and X Secretory Phospholipases A2. PMID: 28528433
  2. Data show that phospholipase A2 group IIA, V and X have different target/function related activity. PMID: 26711221
  3. PLA2G10 releases omega-3 polyunsaturated fatty acids, suppresses colitis, and promotes sperm fertility. PMID: 26828067
  4. Endogenous secreted phospholipase A2 group X regulates cysteinyl leukotrienes synthesis by human eosinophils PMID: 26139511
  5. PLA2G10 variants are not significantly associated with plasma sPLA2 activity or with CHD risk. PMID: 25583995
  6. Studies indicate that the expression of secreted phospholipases A2 (sPLA2s), most notably the group IIA, III and X enzymes, is dysregulated in various malignant tissues. PMID: 25286228
  7. sPLA2GIII expression may be used as a risk factor for lymph node metastasis and a prognostic marker in colorectal cancer. In addition, sPLA2GIII and sPLA2GX may play opposing roles in colorectal carcinogenesis PMID: 25964585
  8. hGX sPLA2 is a novel modulator of lipid metabolism that promotes breast cancer cell growth and survival by stimulating lipid droplet formation and fatty acid oxidation. PMID: 24070020
  9. Data indicate that the expression of genes encoding hGIIA, hGIII and hGX sPLA2s (PLA2G2A, PLA2G3 and PLA2G10, respectively) in breast tumour biopsies differs from that in normal tissues. PMID: 24508801
  10. The enzyme activity of sPLA2 is not altered in serum and cerebrospinal fluid of patients with relapsing-remitting multiple sclerosis during the course of the disease. PMID: 23859159
  11. Secreted phospholipase A2 group X plays a key role in regulating eicosanoid formation and the development of inflammation and airway hyperresponsiveness in murine models. PMID: 23614662
  12. PLA2G10 expression in bone marrow cells controls a proatherogenic Th1 response and limits the development of atherosclerosis. PMID: 23349189
  13. Molecular details of membrane fluidity changes during apoptosis and relationship to phospholipase A(2) activity PMID: 22967861
  14. CONCLUSION: hGX-sPLA(2) secreted in inflamed tissues can contribute to local dendritic cell maturation, resulting in pro-Th1 cells, through the production of various lipid mediators from hydrolysis of either LDL and/or cell plasma membrane. PMID: 22494626
  15. the use of a highly potent indole-based inhibitor of hGX-sPLA(2), RO061606 (which is ineffective against mGX-sPLA(2)), to assess the potential utility of GX-sPLA(2) blockade as a therapeutic intervention in asthma. PMID: 21652694
  16. Group X secreted phospholipase A2 proenzyme is matured by a furin-like proprotein convertase and releases arachidonic acid inside of human HEK293 cells PMID: 21878635
  17. sPLA(2) -IIA and sPLA(2) -X are the major sPLA(2) s in human airways, and suggest a link between the levels of sPLA(2) -X in the airways and several features of asthma. PMID: 21255140
  18. GX sPLA(2) promotes Ang II-induced pathological responses leading to abdominal aortic aneurysm formation PMID: 20833395
  19. Eosinophil cysteinyl leukotriene synthesis is mediated by exogenous secreted phospholipase A2 group X PMID: 20974857
  20. Group X secreted phospholipase A2 induces production of VEGF-A and VEGF-C from lung macrophages by a receptor-mediated, catalytically independent mechanism and may play an important role in inflammatory and neoplastic angiogenesis and lymphangiogenesis. PMID: 20357262
  21. circulating human neutrophils express groups V and X sPLA(2) (GV and GX sPLA(2)) mRNA and contain GV and GX sPLA(2) proteins, whereas GIB, GIIA, GIID, GIIE, GIIF, GIII, and GXII sPLA(2)s are undetectable PMID: 11741884
  22. LDL modification by GXPLA2 PMID: 12021277
  23. Expressed in human colorectal adenocarcinomas PMID: 12048163
  24. crystal structure of human group X secreted phospholipase A2 PMID: 12161451
  25. Modifies lipoproteins, which are involved in the pathogenesis of atherosclerosis (review) PMID: 12664556
  26. Group V sPLA2 may play an important role in promoting atherosclerotic lesion development by modifying LDL particles in the arterial wall, thereby enhancing particle aggregation, retention, and macrophage uptake. PMID: 14962950
  27. Stable expression of human groups IIA and X secreted phospholipases A(2) (hGIIA and hGX) in CHO-K1 and HEK293 cells leads to serum- and interleukin-1beta-promoted arachidonate release. PMID: 15007070
  28. group X secreted phospholipase A2 is expressed in neural cells and has neuritogenic action PMID: 15781456
  29. This study showed that GX sPLA2 is present in human atherosclerotic lesions and that the hydrolysis of LDL cholesterol by GX sPLA2 results in a modified particle that induces lipid accumulation in human monocyte-derived macrophages. PMID: 17077289
  30. secretory phospholipase A2 group X enhances anti-inflammatory responses, promotes lipid accumulation, and contributes to aberrant lung pathology PMID: 18511424
  31. rate and specificity of hydrolysis are affected by relative increases in endogenous SM and free cholesterol (FC) during the lipase digestion PMID: 18587072
  32. The T-512C polymorphism located in the 5' untranslated region of the secreted phospholipase A2 group X gene associated with a decreased risk of recurrent cardiovascular events during follow-up. PMID: 19495570
  33. Recombinant hGX sPLA2 can efficiently hydrolyze PAF unlike the others secreted PLA2s; thus hGX sPLA2 may be a novel player in PAF regulation during inflammatory processes. PMID: 16962371

Show More

Hide All

Subcellular Location
Secreted. Lysosome. Cytoplasmic vesicle, secretory vesicle, acrosome.
Protein Families
Phospholipase A2 family
Tissue Specificity
Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon. Expressed in neuronal fibers in dorsal root ganglia and in peripheral tissues including stomach, white adipose tissue and prostate (at protein level).
Database Links

HGNC: 9029

OMIM: 603603

KEGG: hsa:8399

STRING: 9606.ENSP00000393847

UniGene: Hs.567366

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*