Recombinant Human Heat shock factor-binding protein 1 (HSBP1), partial

Code CSB-RP004544h
Abbreviation Recombinant Human HSBP1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Heat shock factor binding protein 1; Heat shock factor-binding protein 1; HSBP1; HSBP1_HUMAN; HSF1BP; Nasopharyngeal carcinoma associated antigen 13; Nasopharyngeal carcinoma-associated antigen 13; NPC A 13 ; NPC-A-13; NPCA 13
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-75aa
Target Protein Sequence
MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.5kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.
Gene References into Functions
  1. HSPB1 protects cells against proapoptotic agents when expressed at high level, while inhibition of its expression has been found to predispose cells to apoptosis. PMID: 28828227
  2. Results presented here show that acquisition of a positive charge in HSBP1, either by protonation of His124 or its substitution by lysine, reduces the stability of the dimer interface of the alpha-crystallin domain, increases oligomeric size, and modestly increases chaperone activity. PMID: 28332148
  3. HSBP1 is crucial for regulating resistance to radiotherapy of oral squamous epithelial carcinoma cells by inducing stem-like status. PMID: 24816843
  4. HspBP1 inhibited the cytotoxic activity of the Tag7-Hsp70 complex secreted by lymphocytes. HspBP1 PMID: 21247889
  5. This study reports the crystal structure of a degradation-resistant fragment of HSBP1. A continuous, long-helix conformation of HSBP1 assembles into a coiled-coil three-helix bundle and subsequently into an elongated, symmetrical hexamer. PMID: 18767159
  6. HSBP likely mediates its function through its trimerization domain. PMID: 11679589

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
HSBP1 family
Database Links

HGNC: 5203

OMIM: 604553

KEGG: hsa:3281

STRING: 9606.ENSP00000392896

UniGene: Hs.250899

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*