| Code | CSB-EP010155HU |
| Abbreviation | Recombinant Human HBG1 protein |
| MSDS | |
| Size | US$256 |
| Order now | |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
Discover the potential of our Recombinant Human HBG1, a high-quality reagent specifically designed for researchers working on signal transduction. Hemoglobin subunit gamma-1, also known as gamma-1-globin, is an essential component of fetal hemoglobin, playing a vital role in oxygen transport during early development. This product is engineered to deliver accurate and reliable results for your research projects.
Recombinant Human HBG1 is produced in E.coli, featuring the full length of the mature protein with an expression region ranging from 2-147 amino acids. The protein is N-terminal 10xHis-tagged and C-terminal Myc-tagged, allowing for straightforward purification and detection strategies. With a purity greater than 85% as determined by SDS-PAGE, this reagent ensures consistent performance and quality in your experimental workflows. Available in both liquid and lyophilized powder forms, Recombinant Human HBG1 offers the versatility to accommodate your specific research needs.
There are currently no reviews for this product.
Do you have them: HBG1?
I am looking for the control protein for HbH (β4) and Barts (γ4) · I am studying the haemoglobin variants and I couldn't able to find these two controls for my study. The closest protein I found is HBG1.HBG2 for barts and HBB for HbH. However, I am not sure whether this is the right protein to choose.
GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH