Recombinant Human High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (PDE7A)

Code CSB-YP618810HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP618810HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP618810HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP618810HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP618810HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PDE7A
Uniprot No.
Alternative Names
5''-cyclic phosphodiesterase 7A; HCP 1; HCP1; High affinity cAMP specific 3'5' cyclic phosphodiesterase 7A; High affinity cAMP-specific 3''; P2A; PDE 7; PDE 7A; PDE1/PDE2 yeast human complement of; PDE7; PDE71; PDE7A; PDE7A_HUMAN; Phosphodiesterase 7A; Phosphodiesterase isozyme 7; Phosphodiesterase7A; Rolipram insensitive phosphodiesterase type 7 ; TM 22; TM22
Species
Homo sapiens (Human)
Expression Region
1-456
Target Protein Sequence
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS
Protein Length
full length of isoform PDE7A2
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction.
Gene References into Functions
  1. Low PDE7A expression is associated with sepsis. PMID: 28356347
  2. PDE7A is a high-speed and low-affinity phosphodiesterase for cCMP. PMID: 25128584
  3. PDE7 has roles in regulating oligodendrocyte precursor survival and differentiation during brain development and in adulthood PMID: 23661015
  4. PDE7 has the potential to regulate human T cell function including cytokine production, proliferation and expression of activation markers. PMID: 12067300
  5. Ubiquitous expression of phosphodiesterase 7A in human proinflammatory and immune cells; PDE7A was expressed in neutrophils and alveolar macrophages PMID: 12388353
  6. crystal structure of PDE7A1 catalytic domain complexed with the inhibitor 3-isobutyl-1-methylxanthine & kinetic analysis on mutant PDE7A1 and PDE4D2; results show several residues must work together to switch inhibitor selectivity between PDE4 & PDE7 PMID: 15994308
  7. results show that specific gene silencing with the RNAi method is a useful tool for inhibiting the gene expression of specific PDEs and that PDE7 silencing upregulates several osteogenic genes and increases mineralization PMID: 18420479

Show More

Hide All

Subcellular Location
[Isoform PDE7A1]: Cytoplasm, cytosol. Note=PDE7A1 (57 kDa) is located mostly to soluble cellular fractions.; [Isoform PDE7A2]: Cytoplasm. Note=PDE7A2 (50 kDa) is located to particulate cellular fractions.
Protein Families
Cyclic nucleotide phosphodiesterase family, PDE7 subfamily
Tissue Specificity
PDE7A1 is found at high levels in skeletal muscle and at low levels in a variety of tissues including brain and heart. It is expressed as well in two T-cell lines. PDE7A2 is found abundantly in skeletal muscle and at low levels in heart.
Database Links

HGNC: 8791

OMIM: 171885

KEGG: hsa:5150

STRING: 9606.ENSP00000385632

UniGene: Hs.527119

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×