Recombinant Human High mobility group nucleosome-binding domain-containing protein 4(HMGN4)

Code CSB-EP010576HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O00479
Relevance Non-histone chromosomal protein HMG-17-like 3
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names HMGN4
Protein Names Recommended name: High mobility group nucleosome-binding domain-containing protein 4 Alternative name(s): Non-histone chromosomal protein HMG-17-like 3 Short name= Non-histone chromosomal protein
Expression Region 1-90aa
Tag Info N-terminal GST-tagged
Mol. Weight 36.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Nucleus
Protein Families HMGN family
Database Links

HGNC: 4989

KEGG: hsa:10473

STRING: 9606.ENSP00000327691

UniGene: Hs.236774

Related Products

HMGN4 Antibodies

HMGN4 Antibodies for Homo sapiens (Human)

HMGN4 Antibodies for Human

HMGN4 Proteins

HMGN4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.