Code | CSB-RP016044h |
Product Type | Recombinant Protein |
Size | US$162 |
Uniprot No. | P09429 |
Relevance | DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type Cytoplasmic domain processes in developing cells . |
Image | |
Storage Buffer | Tris-based buffer,50% glycerol |
Alias | High mobility group protein 1 ;HMG-1 |
Species | Homo sapiens (Human) |
Purity | Greater than 90% as determined by SDS-PAGE. |
Sequence | KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE |
Research Area | Epigenetics and Nuclear Signaling |
Protocol |
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
|
Source | E.coli |
Gene Names | HMGB1 |
Expression Region | 8-179aa |
Tag Info | N-terminal GST-tagged |
Mol. Weight | 46.7kDa |
Protein Description | Partial |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury |
Subcellular Location | Nucleus, Chromosome, Cytoplasm, Secreted, Cell membrane, Peripheral membrane protein, Extracellular side, Endosome, Endoplasmic reticulum-Golgi intermediate compartment |
Protein Families | HMGB family |
Tissue Specificity | Ubiquituous. Expressed in platelets (PubMed:11154118). |
Database Links |
HGNC: 4983 OMIM: 163905 KEGG: hsa:3146 STRING: 9606.ENSP00000343040 UniGene: Hs.434102 |
Pathway |
Autophagy
Necroptosis DNA repair pathway |
HMGB1 Antibodies for Human
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA010553YD01HU | HMGB1 Antibody, Biotin conjugated | Human | ELISA |
CSB-PA01604A0Rb | HMGB1 Antibody | Human, Mouse | ELISA, WB, IHC |
CSB-PA010553YB01HU | HMGB1 Antibody, HRP conjugated | Human | ELISA |
CSB-PA010553YA01HU | HMGB1 Antibody | Human, Mouse | ELISA, WB, IHC, IF |
CSB-PA010553YC01HU | HMGB1 Antibody, FITC conjugated | Human | ELISA |
HMGB1 Antibodies for Homo sapiens (Human)
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA01604B0Rb | HMGB1 Antibody, HRP conjugated | Human | ELISA |
CSB-PA01604C0Rb | HMGB1 Antibody, FITC conjugated | Human | ELISA |
CSB-PA01604D0Rb | HMGB1 Antibody, Biotin conjugated | Human | ELISA |
CSB-PA010553GA01HU | HMGB1 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
CSB-PA049959 | HMGB1 Antibody | Human,Mouse,Rat | ELISA,WB |
CSB-PA000149 | Acetyl-HMGB1 (K12) Antibody | Human,Mouse,Rat | WB,ELISA |
CSB-PA005927 | HMGB1 Antibody | Human,Mouse,Rat | WB,ELISA |
CSB-PA995991 | HMGB1 Antibody | Human,Mouse,Rat | ELISA,IHC |
CSB-PA225274 | HMGB1 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
HMGB1 Antibodies for
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA002937 | HMGB1 Antibody | Human,Mouse,Rat | WB,IHC,IF,ELISA |
HMGB1 Proteins for Homo sapiens (Human)
Code | Product Name | Source |
---|---|---|
CSB-YP010553HU | Recombinant Human High mobility group protein B1(Hmgb1) | Yeast |
CSB-EP010553HU CSB-BP010553HU CSB-MP010553HU |
Recombinant Human High mobility group protein B1(HMGB1) | E.coli Baculovirus Mammalian cell |
HMGB1 ELISA Kit for Homo sapiens (Human)
Code | Product Name | Sample Types | Sensitivity |
---|---|---|---|
CSB-E08223h | Human High mobility group protein B1,HMGB-1 ELISA Kit | serum, plasma, tissue homogenates, cell lysates | 19.5 pg/mL |
Recombinant Human Estrogen receptor beta(ESR2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cytochrome P450 11B2, mitochondrial(CYP11B2)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rabbit E-selectin (SELE),partial
Express system: Yeast
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Human Tumor necrosis factor ligand superfamily member 6(FASLG),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Sulfotransferase family cytosolic 1B member 1(Sult1b1)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Mouse Hepatoma-derived growth factor(Hdgf)
Express system: Yeast
Species: Mus musculus (Mouse)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.