Recombinant Human High mobility group protein B1(HMGB1),partial

Code CSB-RP016044h
Product Type Recombinant Protein
Size US$1726
Uniprot No. P09429
Relevance DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type Cytoplasmic domain processes in developing cells .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias High mobility group protein 1 ;HMG-1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE
Research Area Epigenetics and Nuclear Signaling
Protocol
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
Source E.coli
Gene Names HMGB1
Expression Region 8-179aa
Tag Info N-terminal GST-tagged
Mol. Weight 46.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury
Subcellular Location Nucleus, Chromosome, Cytoplasm, Secreted, Cell membrane, Peripheral membrane protein, Extracellular side, Endosome, Endoplasmic reticulum-Golgi intermediate compartment
Protein Families HMGB family
Tissue Specificity Ubiquituous. Expressed in platelets (PubMed:11154118).
Database Links

HGNC: 4983

OMIM: 163905

KEGG: hsa:3146

STRING: 9606.ENSP00000343040

UniGene: Hs.434102

Pathway Autophagy
Necroptosis
DNA repair pathway

Related Products

HMGB1 Antibodies

HMGB1 Antibodies for Human

HMGB1 Antibodies for Homo sapiens (Human)

HMGB1 Antibodies for

HMGB1 Proteins

HMGB1 Proteins for Homo sapiens (Human)

HMGB1 ELISA Kit

HMGB1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.