Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Transcription
Alternative Names
G1/S transition control protein binding protein RbAp46; Histone acetyltransferase type B subunit 2; Histone binding protein RBBP7; Histone-binding protein RBBP7; MGC138867; MGC138868; Nucleosome remodeling factor subunit RBAP46; Nucleosome-remodeling factor subunit RBAP46; RBAP46; RBBP 7; RBBP-7; RBBP7; RBBP7_HUMAN; Retinoblastoma binding protein 7; Retinoblastoma binding protein p46; Retinoblastoma-binding protein 7; Retinoblastoma-binding protein p46; Retinoblastoma-binding protein RbAp46
Species
Homo sapiens (Human)
Expression Region
1-425aa
Target Protein Sequence
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human RBBP7 covers amino acids 1-425. This RBBP7 protein is expected to have a theoretical molecular weight of 63.8 kDa. The RBBP7 protein was expressed in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the RBBP7 encoding gene fragment was conducted, allowing for easier detection and purification of the RBBP7 protein in subsequent stages.
Human Retinoblastoma-Binding Protein 7 (RBBP7) is a histone-binding protein essential for chromatin remodeling and gene regulation. As a subunit of various chromatin-modifying complexes, RBBP7 participates in epigenetic processes, influencing transcriptional activation and repression. In cell cycle regulation, RBBP7 interacts with tumor suppressor proteins, impacting cell proliferation. In cancer research, RBBP7 is implicated in tumorigenesis and metastasis, making it a potential therapeutic target. Additionally, RBBP7 plays a role in stem cell maintenance and differentiation. Investigating RBBP7's functions enhances the understanding of epigenetic mechanisms, offering avenues for research in cancer biology, developmental biology, and therapeutic strategies targeting chromatin dynamics.