Recombinant Human Histone-lysine N-methyltransferase 2A (KMT2A), partial

Code CSB-YP014627HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP014627HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP014627HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP014627HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP014627HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Histone-lysine N-methyltransferase 2A; Lysine N-methyltransferase 2A; EC 2.1.1.364; ALL-1; CXXC-type zinc finger protein 7; Cysteine methyltransferase KMT2A; EC 2.1.1.-; Myeloid/lymphoid or mixed-lineage leukemia; Myeloid/lymphoid or mixed-lineage leukemia protein 1; Trithorax-like protein; Zinc finger protein HRX; [Cleaved into: MLL cleavage product N320; N-terminal cleavage product of 320 kDa; p320; MLL cleavage product C180; C-terminal cleavage product of 180 kDa; p180] KMT2A ALL1 CXXC7 HRX HTRX MLL MLL1 TRX1
Species
Homo sapiens (Human)
Expression Region
1635-1765
Target Protein Sequence
ALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERV
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Histone methyltransferase that plays an essential role in early development and hematopoiesis. Catalytic subunit of the MLL1/MLL complex, a multiprotein complex that mediates both methylation of 'Lys-4' of histone H3 (H3K4me) complex and acetylation of 'Lys-16' of histone H4 (H4K16ac). Catalyzes methyl group transfer from S-adenosyl-L-methionine to the epsilon-amino group of 'Lys-4' of histone H3 (H3K4) via a non-processive mechanism. Part of chromatin remodeling machinery predominantly forms H3K4me1 and H3K4me2 methylation marks at active chromatin sites where transcription and DNA repair take place. Has weak methyltransferase activity by itself, and requires other component of the MLL1/MLL complex to obtain full methyltransferase activity. Has no activity toward histone H3 phosphorylated on 'Thr-3', less activity toward H3 dimethylated on 'Arg-8' or 'Lys-9', while it has higher activity toward H3 acetylated on 'Lys-9'. Binds to unmethylated CpG elements in the promoter of target genes and helps maintain them in the nonmethylated state. Required for transcriptional activation of HOXA9. Promotes PPP1R15A-induced apoptosis. Plays a critical role in the control of circadian gene expression and is essential for the transcriptional activation mediated by the CLOCK-ARNTL/BMAL1 heterodimer. Establishes a permissive chromatin state for circadian transcription by mediating a rhythmic methylation of 'Lys-4' of histone H3 (H3K4me) and this histone modification directs the circadian acetylation at H3K9 and H3K14 allowing the recruitment of CLOCK-ARNTL/BMAL1 to chromatin. Also has auto-methylation activity on Cys-3882 in absence of histone H3 substrate.
Gene References into Functions
  1. our work shows that ALOX5 plays a moderate anti-tumor role and functions as a drug sensitizer, with a therapeutic potential, in MLL-rearranged AML. PMID: 28500307
  2. Studied lysine methyltransferase 2A (KMT2A) genetic rearrangements in child and young adult T-lymphoblastic leukemia/lymphoma. PMID: 30203571
  3. Our experience suggests that AML with KMT2A rearrangement should be considered for the differential diagnosis of infantile cases with atypical monocytosis suggestive of JMML. Cytogenetic studies, including fluorescence in situ hybridization analysis of KMT2A, may be helpful in distinguishing between AML with KMT2A rearrangement and JMML. PMID: 30143999
  4. Replication stress-induced recruitment of EndoG to the MLLbcr. PMID: 28626219
  5. Wiedemann-Steiner syndrome causative splice and missense variants lead to reduction of KMT2A function. PMID: 29203834
  6. SETD2 is required to maintain high H3K79 di-methylation and MLL-AF9-binding to critical target genes, such as Hoxa9. PMID: 29777171
  7. One of the USP10 targets is TP53. Wildtype TP53 is usually rescued from proteasomal degradation by USP10. As most KMT2A leukemias display wildtype p53 alleles, one might argue that the disruption of an USP10 allele can be classified as a pro-oncogenic event. PMID: 30107050
  8. this work highlights that MLLr AML comprises of an AML subgroup affecting younger patients with poor prognosis. The allo-HSCT in MRD-negative patients could be the best therapeutic option. PMID: 29384595
  9. Myeloid Zinc Finger 1 and GA Binding Protein Co-Operate with Sox2 in Regulating the Expression of Yes-Associated Protein 1 in Cancer Cells PMID: 28905448
  10. This study demonstrates a tractable approach for respecifying iPSC-derived blood cells into highly engraftable hematopoietic stem and progenitor cells (HSPCs) through transient expression of a single transcription factor, MLL-AF4 PMID: 29386396
  11. the influence of TGFbeta/SMADs on MLL- and MLL-AF4-mediated 5-LO promoter activation PMID: 28803964
  12. Chromosomal translocations involving MLL1 appear to directly perturb the regulation of multiple chromatin-associated complexes to allow inappropriate expression of developmentally regulated genes and thus drive leukemia development. [review] PMID: 28242784
  13. FLT3 cell-surface expression did not vary by FLT3 mutational status, but high FLT3 expression was strongly associated with KMT2A rearrangements. Our study found that there was no prognostic significance of FLT3 cell surface expression in pediatric Acute Myeloid Leukemia PMID: 28108543
  14. results indicate that KMT2A promotes melanoma growth by activating the hTERT signaling, suggesting that the KMT2A/hTERT signaling pathway may be a potential therapeutic target for melanoma. PMID: 28726783
  15. A novel regulatory pathway for MLL1, which may open a new therapeutic approach to MLL-rearrangement leukaemia. PMID: 28939057
  16. data confirm MLL-PTD and, to a lesser extent, FLT3-ITD as common events in +11 AML.6, 7, 8 However, the high mutation frequencies of U2AF1 and genes involved in methylation (DNMT3A, IDH2) have hitherto not been reported in +11 AML PMID: 27435003
  17. It is, to our knowledge, the first case of B acute lymphoblastic leukemia with this fusion gene. At the molecular level, two rearrangements were detected using RNA sequencing juxtaposing exon 7 to exon 2 and exon 9 to intron 1-2 of the KMT2A and MAML2 genes respectively, and one rearrangement using Sanger sequencing juxtaposing exon 8 and exon 2. PMID: 28535805
  18. The most common KMT2A breakpoint region was intron/exon 9 (3/8 patients), followed by intron/exon 11 and 10. PMID: 27282883
  19. study describes 2 patients with Wiedemann-Steiner syndrome who presented with variable severity; findings revealed a de novo nonsense mutation, p.Gln1978*, of KMT2A in the former, and a missense mutation, p.Gly1168Asp, in the latter PMID: 27777327
  20. Comprehensive genetic analysis of donor cell derived leukemia with KMT2A rearrangement PMID: 28921816
  21. Data show that expression of myeloid-lymphoid leukemia protein (MLL) fusion protein does neither influence DNA signaling nor DNA double strand breaks (DNA-DSBs) repair. PMID: 27119507
  22. In this case study, we diagnosed t-MN with KMT2A rearrangement in a patient with history of B-ALL with 9p deletion and gain of X chromosome. Unusual features associated with this case are discussed PMID: 29155023
  23. Identification of novel biomarkers for MLL-translocated acute myeloid leukemia. PMID: 28911906
  24. Collectively, these data indicated that ATR or ATM inhibition represent potential therapeutic strategies for the treatment of AML, especially MLL-driven leukemias. PMID: 27625305
  25. different cancer mutations in MLL1 lead to a loss or increase in activity, illustrating the complex and tumor-specific role of MLL1 in carcinogenesis. PMID: 28182322
  26. we report two boys with novel KMT2A mutations from Chinese origin for the first time. They do not show one of the characteristic WDSTS phenotype, cubiti hypertrichosis. Instead, both of them had absent palmar proximal transverse crease. The feature was not linked to WDSTS patients previously. Our findings extend the WDSTS phenotypic spectrum. PMID: 27759909
  27. Whole exome sequencing allowed identifying a previously unreported de novo KMT2A missense mutation affecting the DNA binding domain of the methyltransferase. This finding expands the clinical phenotype associated with KMT2A mutations to include immunodeficiency and epilepsy as clinically relevant features for this disorder. PMID: 27320412
  28. These results define an important role for MLL1 in regulating macrophage-mediated inflammation in wound repair and identify a potential target for the treatment of chronic inflammation in diabetic wounds. PMID: 28663191
  29. MLL rearrangement is associated with infant acute lymphoblastic leukemia. PMID: 27588400
  30. These results reveal a cooperative transcriptional activation mechanism of AEP and DOT1L and suggest a molecular rationale for the simultaneous inhibition of the MLL fusion-AF4 complex and DOT1L for more effective treatment of MLL-rearranged leukemia. PMID: 28394257
  31. this indicates that DOT1L function, like MLL, does not completely rely on its methyltransferase activity. Nevertheless, the small molecule DOT1L inhibition is sufficient to block the proliferation of MLL fusion-induced leukemia cells of murine and human origin PMID: 26923329
  32. Studies demonstrate that histone methyl-transferase MLL1 coordinates with HIF1alpha and histone acetyltransferase p300 and regulate hypoxia-induced HOTAIR expression. The hypoxia-induced upregulation of HOTAIR expression may contribute to its roles in tumorigenesis. PMID: 28756022
  33. MLL1 and MLL2 collaborate to regulate gene expression and leukemia maintenance not through redundancy, but through distinct pathways. PMID: 28609655
  34. MLL1, deposits H3K4me2 at CpG-dense regions that could serve as polycomb response elements. PMID: 27447986
  35. A patient was diagnosed with Wiedemann-Steiner syndrome based on identification of a novel de novo pathogenic variant in the KMT2A gene. PMID: 28359930
  36. MLL gene rearrangement is associated with acute lymphocytic leukemia. PMID: 27343252
  37. Our data thus extend MLL1 function to H3K4 methylation and PD-L1 transcription activation in pancreatic cancer cells. PMID: 28131992
  38. KMT2A gene rearrangement is associated with acute megakaryoblastic leukemia in non-Down syndrome. PMID: 28063190
  39. The data revealed the presence of a partial tandem duplication of the MLL gene as the only detectable copy number change and 11 non-silent somatic mutations, including DNMT3A R882H and NRAS G13D. All somatic lesions were present both at initial MDS/MPN-U diagnosis and at AML presentation at similar mutant allele frequencies. PMID: 27240832
  40. KMT2A rearrangement is associated with B-cell lymphoblastic leukemia. PMID: 27786413
  41. Loss of MLL-AF4 activity results in a reduction of H3K79me3 levels in the gene body and H3K27Ac levels at the 3' BCL-2 enhancer, revealing a novel regulatory link between these two histone marks and MLL-AF4-mediated activation of BCL-2. PMID: 27856324
  42. Results revealed that double minute chromosomes in myeloid neoplasms commonly harbor MYC or MLL gene amplification and manifest as micronuclei within leukemic blasts. PMID: 27318442
  43. Targeted Disruption of the Interaction between WD-40 Repeat Protein 5 (WDR5) and Mixed Lineage Leukemia (MLL)/SET1 Family Proteins Specifically Inhibits MLL1 and SETd1A Methyltransferase Complexes. PMID: 27563068
  44. miR-155 levels are correlated with MLL translocations, but that miR-155 expression is dispensable for the formation of AML and has no effect on leukemia progression. PMID: 27619068
  45. MLL-ENL dysregulated the proliferative and repopulating capacity of hematopoietic stem cells. PMID: 25456127
  46. This review summarizes and discusses the general mechanisms of H3K4 methylation, and how the six main enzymes from the SET/MLL family (responsible for H3K4me1/me2/me3) function in hematopoiesis and in hematologic malignancies. [review] PMID: 27796741
  47. Results show that human MLL-AF9 expression in mouse long-term hematopoietic stem cells causes invasive, chemoresistant acute myeloid leukemia that expresses genes related to epithelial-mesenchymal transition. PMID: 27344946
  48. Authors evaluated the expression levels of the MLL gene in AML patients. PMID: 27561414
  49. Results show that MLL-AF9 reduces Id2 and increases E2-2 expression to drive and sustain leukemia stem cell potential in MLL-rearranged acute myeloid leukemia (AML). Low expression of Id2 or of an Id2 gene signature is associated with poor prognosis in not only MLL-rearranged but also t(8;21) AML patients. PMID: 27374225
  50. Pygo2 functions as a prognostic factor for glioma due to its up-regulation of H3K4me3 and promotion of MLL1/MLL2 complex recruitment. PMID: 26902498

Show More

Hide All

Involvement in disease
Wiedemann-Steiner syndrome (WDSTS)
Subcellular Location
Nucleus.; [MLL cleavage product N320]: Nucleus.; [MLL cleavage product C180]: Nucleus. Note=Localizes to a diffuse nuclear pattern when not associated with MLL cleavage product N320.
Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, TRX/MLL subfamily
Tissue Specificity
Heart, lung, brain and T- and B-lymphocytes.
Database Links

HGNC: 7132

OMIM: 159555

KEGG: hsa:4297

STRING: 9606.ENSP00000436786

UniGene: Hs.258855

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1