Name: Recombinant Human Homeobox protein OTX2 (OTX2)
Brand: CUSABIO
SKU: CSB-EP017299HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

OTX2

Uniprot No.

P32243

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

CPHD6; Homeobox protein OTX2; MCOPS 5; MCOPS5; MGC45000; Orthodenticle 2; Orthodenticle homeobox 2; Orthodenticle homolog 2 (Drosophila); Orthodenticle homolog 2; Orthodenticle2; Otx 2; otx2; OTX2_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-297aa

Target Protein Sequence

MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

48.4kDa

Protein Length

Full Length of Isoform 2

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

1. It is listed as 1-297aa, but UniProt only listed 289aa full length, could you confirm the length of the protein?
2. Since it is purified with NiNTA columns, can the final product be prepared imidazole free (or ultra low concentration)?
http://www.cusabio.com/Recombinant-Protein/Recombinant-human-Homeobox-protein-OTX2-Mammalian-cell-12547833.html

Very nice to receive your inquiry. Recombinant human Homeobox protein OTX2
CSB-YP017299HU
CSB-EP017299HU
CSB-BP017299HU
CSB-MP017299HU
Expression Region: 1-297aa, full length of Isoform 2
Tag Info: EP: N-terminal 6xHis-sumo-tag; YP, BP, MP: N-terminal 6xHis-tag
Target Protein Sequence:

We could provide the final product free of imidazole. Please kindly remark this requirement when sending your PO.

1. Is there (a way) to make the protein with N-term His but no SUMO?
2. any changes in lead time for 5mg?
3. confirming immidazole free, and supply protein in PBS?

Thanks for your inquiry. Yes. We could offer the EP protein with N-terminal His-tag, but the price and lead time will change. The product details are as below.
Code: CSB-EP017299HU
Name: Recombinant human Homeobox protein OTX2
Distributor Price: 40-50 working days
Tag Info: N-terminal 6xHis-tag
Buffer: If you would like the protein supplied in PBS, free of immidazole. Please just remark this requirement when sending your PO.
Because CSB-EP017299HU with N-terminal 6xHis-sumo-tag is a stock protein, so the price is relatively cheaper.
The lead time will be 25-30 working days.

Can you calculated the molar concentration of the protein we delivered?

The molar concentration of CSB-EP017299HU is 0.037mol/L.

I have a few questions regarding the Catalog # CSB-EP017299HU Recombinant Human Homeobox protein OTX2(OTX2):
1. Is there a version of the protein with only N-terminal 6xHis tag?
2. Can the protein be supplied in PBS instead of Tris-based buffer?
3. My downstream application requires that the protein is in imidazole-free buffer. Does the protein solution go through dialysis steps to remove imidazole from elution buffer?

Very nice to receive your inquiry.
1. For CSB-EP017299HU, we could also provide N-terminal 6xHis tag. Because CSB-EP017299HU with N-terminal 6xHis-sumo-tag is a stock protein, so the price will be relatively cheaper.
2. If the customer would like the protein supplied in PBS, free of immidazole. Please just remark this requirement when sending your PO.

Target Background

Function

Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Gene References into Functions

This second report of maculopathy associated with a heterozygous mutation in OTX2 confirms that mutations in OTX2 should be considered in the differential diagnosis of atypical hereditary maculopathy, with or without rod-cone dystrophy. PMID: 29204067
OTX2 acts as a pioneer factor and, in cooperation with NEUROD1, controls the group 3 medulloblastoma active enhancer landscape. PMID: 28213356
Syndromic microphthalmia due to mutations in OTX2 can present with significant intrafamilial phenotypic variability. PMID: 28388256
We report a rare case of inherited 14q22.3 deletion in a very large family presenting with variable features of eye abnormalities (microphthalmia, anophthalmia and peripapillary pigmentation), pituitary anomalies, and learning difficulties. PMID: 26860946
Our data refine the clinical spectrum associated with OTX2 mutations and suggests that OTX2 haploinsufficiency should be considered as a possible cause for isolated mandibular dysostosis. PMID: 27378064
One subgroup of atypical teratoid rhabdoid tumors was characterized by high expression of OTX2. PMID: 28025236
TNF-alpha, secreted from activated Monocytes, mediates the downregulation of OTX2 and essential retinal pigment epithelium genes. PMID: 27660103
OTX2 gene frameshift mutation is associated with microphthalmia, ectopic pituitary and growth hormone deficiency. PMID: 26974134
OTX2 mutations can cause ACTH deficiency in the neonatal period. Study also shows that OTX2 mutations are associated with agenesis of the Left Internal Carotid Artery. PMID: 27299576
A novel pathogenic variant in OTX2, c.651delC, p.(Thr218Hisfs*76) identified in a patient with syndromic bilateral anophthalmia . PMID: 26130484
demonstrated the role of OTX2 on TAp63 regulation necessary for the correct formation of macular neuroepithelium PMID: 26554466
A novel role for OTX2 in self-renewal and migration of human embryonic neural precursors and Medulloblastoma cells, is reported. PMID: 26398939
We showed that miR-410 directly regulates predicted target genes OTX2 and RPE65. PMID: 25351180
This epigenome-wide DNA methylation analysis in postmortem hippocampus and prefrontal cortex specimens confirmed OTX2 DNA methylation profiles in major depression PMID: 25571874
OTX2 overexpression is associated with medulloblastoma. PMID: 25198066
SOX2, OTX2 and PAX6 analysis in subjects with anophthalmia and microphthalmia PMID: 25542770
Agnathia-otocephaly complex and asymmetric velopharyngeal insufficiency due to an in-frame duplication in OTX2. PMID: 25589041
OTX2 mutations cause autosomal dominant pattern dystrophy of the retinal pigment epithelium. PMID: 25293953
Endogenous OTX2 from a medulloblastoma cell line is O-GlcNAcylated at several sites. PMID: 24580054
a role for OTX2 dosage sensitivity in human craniofacial development PMID: 24816892
VEGF-A, Otx2 homeobox and p53 family genes are expressed in proliferative vitreoretinopathy PMID: 24227910
OTX2 gene duplication is associated with autosomal dominant oculoauriculovertebral syndrome. PMID: 23794319
This study showed that OTX2 sustains a bivalent-like state of OTX2-bound promoters in medulloblastoma by maintaining their H3K27me3 levels. PMID: 23179372
Otx2c is a novel alternative splicing variant of Otx2 gene and it is tightly regulated during the differentiation process demonstrating that it may have a potential role in embryonic stem cell maintenance and differentiation. PMID: 23566845
OTX2 functions via its homeobox domain as a suppressor of differentiation, and the loss of OTX2 expression is linked to the myogenesis in medullomyoblastoma. PMID: 22986744
This study reports a large family in which two cousins with micro/anophthalmia each gave birth to at least one child with otocephaly. The study subsequently identified in one unrelated otocephalic patient a sporadic OTX2 mutation. PMID: 22577225
We have identified a novel mutation of the OTX2 gene in a Han Chinese family featuring various anophthalmia and microphthalmia phenotypes. PMID: 22268617
A novel missense heterozygous OTX2 mutation acts as a dominant negative inhibitor of target gene expression in a patient with combined pituitary hormone deficiency (CPHD), pituitary malformation, and optic nerve hypoplasia. PMID: 22715480
MiR-206 regulates Otx2 expression in glioma and neuroblastoma cell lines. PMID: 22508046
silencing of OTX2 inhibited cell proliferation and resulted in a neuronal-like differentiation; downregulated genes were enriched for cycle and visual perception genes; upregulated genes were enriched for genes involved development and differentiation PMID: 21964830
There is no genotype-phenotype correlation and the severity of the disease varies not only by the specific OTX2 mutations but also among individuals harboring the same mutation, suggesting the involvement of multiple levels of regulation. PMID: 22783640
these findings emphasize the role of OTX2 in regulating the human TYR gene, with implications for inter-individual differences in melanin synthesis, retinal development, and function as well as susceptibility to retinal degeneration associated with aging. PMID: 22259223
Mutation analysis was performed after sequencing the entire coding regions of OTX2 and PRRX1 genes isolated from the proband and his parents. After thorough analysis, no DNA variations were detected PMID: 22198066
The OTX2 mutation in c.313C > T causing p.Gln105X and a premature stop codon is consistent with the loss of function mutations observed in A/M patients. PMID: 22204637
OTX2 directly induces a series of cell cycle genes but requires cooperating genes for an oncogenic acceleration of the cell cycle. PMID: 21047732
This high frequency of causal submicroscopic chromosomal aberrations in patients with congenital ocular malformation warrants implementation of array comparative genomic hybridization in the diagnostic work-up of these patients. PMID: 21353197
Four of the five OTX2-positive anophthalmia/microphthalmia patients in our study displayed additional systemic findings, including two novel features, Wolf-Parkinson-White syndrome and an anteriorly placed anus PMID: 20486942
Otx2 is required to specify neuron subtype in ventral tegmental area and confers resistance to 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine-HCl (MPTP) poisoning. PMID: 21057506
SOX9, through interaction with microphthalmia-associated transcription factor (MITF) and OTX2, regulates BEST1 expression in the retinal pigment epithelium. PMID: 20530484
OTX2 overexpression protects dopaminergic neurons in ventral mesencephalic cultures from Parkinson's disease-relevant toxin, 1-methyl-4-phenylpyridinium, whereas OTX2 downregulation using short hairpin RNA increases their susceptibility. PMID: 20573704
The early expression of OTX2 in proliferative cell layers of the human fetal brain supports the concept that this homeobox gene is important in neuronal cell development and differentiation. PMID: 20354145
A novel loss-of-function mutation in OTX2 in a patient with anophthalmia and isolated growth hormone deficiency. PMID: 20396904
OTX2 mutations are associated with variable pituitary phenotype, with no genotype-phenotype correlations, and that OTX2 can transactivate GNRH1 as well as HESX1 and POU1F1. PMID: 19965921
Our findings define OTX2 as an important oncogenic driver in medulloblastoma. PMID: 20028867
Data suggest that OTX2 may regulate retinal pigment epithelium (RPE)-specific target genes, such as DOPAchrome tautomerase (DCT), thereby maintaining the homeostasis of RPE. PMID: 12559959
OTX2 functions to specify the fate of neuroectoderm in various regions of the developing brain. This developmental role is consistent with the evidence suggesting that OTX2 is a medulloblastoma oncogene. PMID: 15705863
Gene expression analyses showed that OTX2 transcripts were present at high levels in 14 of 15 (93%) medulloblastomas with anaplastic histopathologic features. PMID: 15705891
Heterozygous mutations of OTX2 cause severe ocular malformations. PMID: 15846561
Molecular diagnostic of human mutant OTX2 proteins discriminates hypomorphic and loss of function mutations from other mutations that may not be relevant to ocular pathology PMID: 16607563
This review describes how cross regulation for PAX6, SOX2 and perhaps OTX2 has now been uncovered, pointing to the mechanisms that can fine-tune the expression of three such essential components in eye development. PMID: 16712695

Hide All

Involvement in disease

Microphthalmia, syndromic, 5 (MCOPS5); Pituitary hormone deficiency, combined, 6 (CPHD6); Retinal dystrophy, early-onset, with or without pituitary dysfunction (RDEOP)

Subcellular Location

Nucleus.

Protein Families

Paired homeobox family, Bicoid subfamily

Database Links

HGNC: 8522

OMIM: 600037

KEGG: hsa:5015

STRING: 9606.ENSP00000343819

UniGene: Hs.288655

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address