CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-EP017299HU |
Size | US$1726 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | OTX2 |
Uniprot No. | P32243 |
Research Area | Epigenetics and Nuclear Signaling |
Alternative Names | CPHD6; Homeobox protein OTX2; MCOPS 5; MCOPS5; MGC45000; Orthodenticle 2; Orthodenticle homeobox 2; Orthodenticle homolog 2 (Drosophila); Orthodenticle homolog 2; Orthodenticle2; Otx 2; otx2; OTX2_HUMAN |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-297aa |
Target Protein Sequence | MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 48.4kDa |
Protein Length | Full Length of Isoform 2 |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
1. It is listed as 1-297aa, but UniProt only listed 289aa full length, could you confirm the length of the protein?
2. Since it is purified with NiNTA columns, can the final product be prepared imidazole free (or ultra low concentration)?
http://www.cusabio.com/Recombinant-Protein/Recombinant-human-Homeobox-protein-OTX2-Mammalian-cell-12547833.html
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
1. Is there (a way) to make the protein with N-term His but no SUMO?
2. any changes in lead time for 5mg?
3. confirming immidazole free, and supply protein in PBS?
Can you calculated the molar concentration of the protein we delivered?
I have a few questions regarding the Catalog # CSB-EP017299HU Recombinant Human Homeobox protein OTX2(OTX2):
1. Is there a version of the protein with only N-terminal 6xHis tag?
2. Can the protein be supplied in PBS instead of Tris-based buffer?
3. My downstream application requires that the protein is in imidazole-free buffer. Does the protein solution go through dialysis steps to remove imidazole from elution buffer?
Function | Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS) |
Gene References into Functions |
|
Involvement in disease | Microphthalmia, syndromic, 5 (MCOPS5); Pituitary hormone deficiency, combined, 6 (CPHD6); Retinal dystrophy, early-onset, with or without pituitary dysfunction (RDEOP) |
Subcellular Location | Nucleus |
Protein Families | Paired homeobox family, Bicoid subfamily |
Database Links |
HGNC: 8522 OMIM: 600037 KEGG: hsa:5015 STRING: 9606.ENSP00000343819 UniGene: Hs.288655 |