Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Cartilage link protein ; cartilage linking protein 1 ; Cartilage-link protein; Cartilage-linking protein 1; CLP; CRTL1 ; Crtl1l; HAPLN1; HPLN1_HUMAN; Hyaluronan and proteoglycan link protein 1; Hyaluronan and proteoglycan link protein 1 precursor ; LP; Proteoglycan link protein
Species
Homo sapiens (Human)
Expression Region
16-354aa
Target Protein Sequence
DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
CUSABIO synthesized the recombinant gene by integrating the N-terminal 10xHis tag sequence into the targeted gene encoding the 16-354aa of the human HAPLN1. The synthesized gene was subsequently cloned into an expression vector. After cloning, the expression vector was introduced into the Mammalian cell for expression. The product was purified to obtain the recombinant human HAPLN1 protein carrying N-terminal 10xHis tag. The SDS-PAGE assayed the purity of this recombinant HAPLN1 protein greater than 85%. This HAPLN1 protein migrated along the gel to a band of about 42 kDa molecular weight.
HAPLN1 is a gene providing instruction of making a protein named hyaluronan and proteoglycan link protein 1 (also known as proteoglycan link protein) in human and belongs to HAPLN family. The HAPLN gene family includes four members, including HAPLN1, HAPLN2, HAPLN3 and HAPLN4. Among of them, HAPLN1 is expressed in a restricted subset of adult tissues. A study has revealed that HAPLN1 loss in the aged tumor microenvironment drives a breakdown in the crosslinking of the ECM, which promotes melanoma migration while limiting intravasation of tumor-infiltrating lymphocytes.
