Name: Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1)
Brand: CUSABIO
SKU: CSB-MP010130HU

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

HAPLN1

Uniprot No.

P10915

Research Area

Signal Transduction

Alternative Names

Cartilage link protein ; cartilage linking protein 1 ; Cartilage-link protein; Cartilage-linking protein 1; CLP; CRTL1 ; Crtl1l; HAPLN1; HPLN1_HUMAN; Hyaluronan and proteoglycan link protein 1; Hyaluronan and proteoglycan link protein 1 precursor ; LP; Proteoglycan link protein

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

16-354aa

Target Protein Sequence

DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

41.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CUSABIO synthesized the recombinant gene by integrating the N-terminal 10xHis tag sequence into the targeted gene encoding the 16-354aa of the human HAPLN1. The synthesized gene was subsequently cloned into an expression vector. After cloning, the expression vector was introduced into the Mammalian cell for expression. The product was purified to obtain the recombinant human HAPLN1 protein carrying N-terminal 10xHis tag. The SDS-PAGE assayed the purity of this recombinant HAPLN1 protein greater than 85%. This HAPLN1 protein migrated along the gel to a band of about 42 kDa molecular weight.

HAPLN1 is a gene providing instruction of making a protein named hyaluronan and proteoglycan link protein 1 (also known as proteoglycan link protein) in human and belongs to HAPLN family. The HAPLN gene family includes four members, including HAPLN1, HAPLN2, HAPLN3 and HAPLN4. Among of them, HAPLN1 is expressed in a restricted subset of adult tissues. A study has revealed that HAPLN1 loss in the aged tumor microenvironment drives a breakdown in the crosslinking of the ECM, which promotes melanoma migration while limiting intravasation of tumor-infiltrating lymphocytes.

Target Background

Function

Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Gene References into Functions

HAPLN1 reflects a signaling network leading to stemness, mesenchymal commitment and hepatocellular carcinoma progression PMID: 27191501
CSGalNAcT-1 and Hapln-1 may play important roles in the pathogenesis of Kashin-Beck disease and osteoarthritis. PMID: 23748413
HAPLN1 is overexpressed in metastatic melanoma and is secreted exclusively by the tumor cells PMID: 22159717
Single-nucleotide polymorphism in the hyaluronan and proteoglycan link protein 1 (HAPLN1) gene is associated with spinal osteophyte formation and disc degeneration in Japanese women. PMID: 20953637
An in vitro model of perineuronal nets has been developed demonstrating that cartilage link protein (along with hyaluronan synthase) are necessary for their formation. PMID: 20584105
link protein may function as a stabilizer of the interaction between aggrecan and hyaluronan in cartilage and between versican and hyaluronan in many tissues PMID: 14724283
SOX9 is a key regulator of CRTL1 PMID: 15456769
cLP and versican did not bind directly to each other in solution yet formed ternary complexes with hyaluronan PMID: 15590670
Overexpression of HAPLN1 and its SP-IgV domain increases tumorigenic properties of mesothelioma. Thus, targeting the SP-IgV domain may be one of the therapeutic approaches in cancer treatment. PMID: 19351750

Hide All

Subcellular Location

Secreted, extracellular space, extracellular matrix.

Protein Families

HAPLN family

Tissue Specificity

Widely expressed. Weakly expressed in the brain.

Database Links

HGNC: 2380

OMIM: 115435

KEGG: hsa:1404

STRING: 9606.ENSP00000274341

UniGene: Hs.2799

Code	CSB-MP010130HU
Abbreviation	Recombinant Human HAPLN1 protein
MSDS	MSDS Datasheet
Size	$660
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP010130HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) HAPLN1. Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP010130HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) HAPLN1.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage