Recombinant Human Integrin alpha-IIb(ITGA2B),partial

Code CSB-EP011865HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P08514
Relevance Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias GPalpha IIb ;GPIIbPlatelet membrane glycoprotein IIb; CD41
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
Research Area Cardiovascular
Source E.coli
Gene Names ITGA2B
Expression Region 639-887aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 43.0kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.
Involvement in disease Glanzmann thrombasthenia (GT); Bleeding disorder, platelet-type 16 (BDPLT16)
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Integrin alpha chain family
Tissue Specificity Isoform 1 and isoform 2 are expressed in platelets and megakaryocytes, but not in reticulocytes. Not detected in Jurkat, nor in U937 cell lines (PubMed:2351656). Isoform 3 is expressed in prostate adenocarcinoma, as well as in several erythroleukemia, pro
Database Links

HGNC: 6138

OMIM: 187800

KEGG: hsa:3674

STRING: 9606.ENSP00000262407

UniGene: Hs.411312

Pathway PI3K-Akt signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Hematopoietic cell lineage
Rap1 signaling pathway

Related Products

ITGA2B Antibodies

ITGA2B Antibodies for Human

ITGA2B Antibodies for Homo sapiens (Human)

ITGA2B Proteins

ITGA2B Proteins for Homo sapiens (Human)

ITGA2B ELISA Kit

ITGA2B ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.