Recombinant Human Integrin alpha-IIb(ITGA2B),partial

Code CSB-EP011865HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ITGA2B
Uniprot No. P08514
Research Area Cardiovascular
Alternative Names antigen CD41; BDPLT16; BDPLT2; CD41; CD41B; form 2; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; Integrin alpha 2b; Integrin alpha IIb; Integrin alpha-IIb light chain; Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITA2B_HUMAN; Itga2b; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet specific antigen BAK; PPP1R93
Species Homo sapiens (Human)
Source E.coli
Expression Region 639-887aa
Target Protein Sequence CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 43.0kDa
Protein Length Partial
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.
Gene References into Functions
  1. ApoA-IV is a novel ligand of platelet GPIIB IIIA integrin. PMID: 30190457
  2. mutations disturbing the alphaIIb R995/beta3 D723 salt bridge can cause an abnormal maturation of alpha-granules PMID: 29090484
  3. ITGA2B gene mutations associated with Glanzmann thrombasthenia (Review) PMID: 29125375
  4. Sanger sequencing of ITGA2B and ITGB3 in the index case followed by in silico modeling of all known GT-causing missense mutations extending from the lower part of the beta-propeller, and through the thigh and upper calf-1 domains. The index case, a Belgium type I GT patient, identiffied a homozygous c.1772A>C transversion (NC_000017.11:g.44379795T>G) affecting exon 18 of ITGA2B. PMID: 29385657
  5. Kindlin supports platelet GPIIB IIIA activation by interacting with paxillin. PMID: 28954813
  6. Type I Glanzmann thrombasthenia (GT)was found most common in our patients and with lowered mean CD41 expression in comparison with CD61. Type III GT patients had significantly lower numbers of severe bleeders, but the severity of bleeding did not vary significantly in type I and II GT patients PMID: 28948953
  7. this study shows that in the Caucasian population the HPA-3 system confers susceptibility to acute cellular rejection after liver transplantation PMID: 28705752
  8. Case Reports: alterations in the platelet proteome in type I Glanzmann thrombasthenia patients caused by different homozygous delG frameshift mutations in ITGA2B. PMID: 28078347
  9. No genetic abnormalities identified in alpha2IIb and beta3: phenotype overcomes genotype in Glanzmann thrombasthenia. PMID: 27808476
  10. study strongly supported the contribution of the genes ITGA2B, GSN and RHOA and the two pathways "regulation of actin cytoskeleton" and "leukocyte transendothelial migration" to osteoporosis risk. PMID: 27153759
  11. Furthermore, the inside-out activation of GPIIb/IIIa of platelets mediated Streptococcus suis suilysin-induced platelet aggregation. PMID: 27800304
  12. Data suggest that the extreme C terminus of kindlin-2 is essential for interaction with and activation of integrin alphaIIBbeta3; these studies were conducted in macrophage cell line and erythroleukemia cell line. PMID: 28652408
  13. Both in cell lines and in mouse model, the extracellular matrix receptors including the integrin ( ITGA3 and ITGA2B), collagen ( COL5A1), and laminin ( LAMA5) were significantly inhibited by curcumin at messenger RNA and protein levels. PMID: 28618934
  14. Case Report: Reduced binding of mutant FLNa to beta3 and the facilitated recruitment of talin by beta3 on platelet stimulation, explaining the increased alphaIIbbeta3 activation and the ensuing gain-of-platelet functions. PMID: 28428218
  15. Mechanistic basis for the binding of fibrinogen-derived RGD- and AGDV-peptides to the platelet integrin alphaIIb-beta3 has been described. PMID: 28277676
  16. the contribution of PAR1 and PAR4 to thrombin-mediated activation of the platelet fibrin receptor (GPIIbIIIa), is reported. PMID: 27784794
  17. Integrin alpha-IIb beta-3 dependent ERK signaling is regulated by Src and Rho kinases in both Leu33 and Pro33 polymorphic isoforms. PMID: 27923225
  18. Data suggest that CD41 and CD45 expression marked the onset of haemangioblastoma (HB) neovascularisation and the stepwise development of the angioformative period, and also the underlying therapeutic targets of anti-vascular treatment. PMID: 26468019
  19. ITGA2B and ITGA8 have roles in prognosis in clear cell renal cell carcinoma patients PMID: 26198048
  20. Thirteen variants in the ITGA2B locus and 29 variants in the ITGB3 locus were identified. PMID: 27965976
  21. This study shows correlation of blood clot stiffness with platelet integrin alpha-IIb beta3 activity, aspirin usage, and transfusion risk in cardiopulmonary bypass patients. PMID: 26688324
  22. Monomeric fibrin displayed a higher probability of interacting with Integrin alphaIIb beta 3 and a greater binding strength. PMID: 26867579
  23. Data show that immune thrombocytopenia (ITP) is an autoimmune bleeding disorder characterized by low platelet count and presence of IgG autoantibodies to platelet surface glycoproteins, such as alpha IIbbeta3 integrins. PMID: 26301697
  24. Data suggest that the ligand AGDV tetrapeptide binds to ITGB3/GPIIIa subunit and induces complete opening of headpiece of integrin alphaIIb/beta3 complex; AGDV appears to have very little contact with ITGA2B/GPIIb subunit. PMID: 26631735
  25. Analysis showed a protective effect of TT genotype of ITGA2 807 C/T on fibrosis progression rate in Chronic Hepatitis C patients. PMID: 27093792
  26. Activated but ligand-free integrins exist mainly in the compact conformation, whereas fibrin-bound alphaIIbbeta3 predominantly exists in a fully extended, headpiece open conformation. PMID: 26391523
  27. Report novel ITGA2B mutations causing Glanzmann thrombasthenia. PMID: 25373348
  28. Ibrutinib causes GPVI and integrin alphaIIbbeta3 platelet signaling deficiencies that result in formation of unstable thrombi and may contribute toward bleeding. PMID: 26359510
  29. post-treatment of peptides derived from the full-length tail or from the turn motif did not reverse aIIb and aV integrin activation. PMID: 25290158
  30. Data indicate 114 novel missense variants in integrin alpha 2b (ITGA2B) and 68 novel missense variants in integrin beta 3 (ITGB3). PMID: 25827233
  31. Data (including data from molecular dynamic simulations) suggest specific interactions between glycoprotein GPIIb/GPIIIa complex transmembrane/C-terminal domains and talin-1 in cell membrane environment during platelet activation. PMID: 24677266
  32. Anionic lipids in annular positions stabilize the alphaIIbbeta3 transmembrane complex by up to 0.50 +/- 0.02 kcal/mol relative to zwitterionic lipids in a headgroup structure-dependent manner. PMID: 25632962
  33. ITGA2B rs5911 GG genotype is associated with decreased ex vivo antiplatelet activity of ticagrelor in healthy Chinese male subjects. PMID: 24474638
  34. The genetic polymorphism of GP lIb-Illa (GP Ila Leu33Pro) was not noted to affect platelet aggregation. PMID: 25518511
  35. data indicated that GPIIb-IIIa and GPIb levels are mainly affected by platelet size (MPV) but not by their genetic variations; in some acute coronary syndrome patients, production of large platelets with high GPIIb-IIIa and GPIb contents might be stimulated by elevated thrombopoietin PMID: 23941967
  36. Intermolecular transmembrane domain interactions activate integrin alphaIIbbeta3. PMID: 24838247
  37. The mechanism of kindlin-mediated activation of integrin alphaIIbbeta3.Kindlins have little direct effect on alphaIIbbeta3 integrin monomer affinity. PMID: 24210614
  38. Data indicate that mutations in alphaIIbbeta3 integrins decreased ligand binding and adhesion. PMID: 24116162
  39. The association of four common polymorphisms from four candidate genes (COX-1, COX-2, ITGA2B, ITGA2) with aspirin insensitivity PMID: 24244288
  40. ADAP interacts with talin and kindlin-3 to promote platelet Integrin alphaIIbbeta3 activation and stable fibrinogen binding. PMID: 24523237
  41. Increased mean platelet volume values correlated with increased platelet aggregation activity and enhanced GP IIb-IIIa and GP Ib expression. PMID: 24749250
  42. These results map the binding of fibrin to multiple sites in the alphaIIb beta-propeller and further indicate that recognition specificity of alphaIIbbeta3 for fibrin differs from that for soluble fibrinogen. PMID: 24338009
  43. these results establish that GP IIb/IIIa and alphavbeta3 integrins are essential mediators of shear flow-induced cancer cell mechanotransduction PMID: 24176823
  44. Studies indicate that Glanzmann thrombasthenia (GT) is caused by quantitative or qualitative deficiencies of alphaIIbbeta3, an integrin coded by the ITGA2B and ITGB3 genes. PMID: 23929305
  45. Our data indicate an important role for the region that links the distal calf-2 and beta-tail domains to their respective transmembrane (TM) domains in transmitting the conformational changes in the TM domains associated with inside-out activation. PMID: 24136164
  46. dRP is a novel autocrine amplifier of platelet activity, which acts on platelet redox levels and modulates integrin alphaIIbbeta3 PMID: 23494007
  47. Platelets lacking ERp57 have defective activation of the alphaIIbbeta3 integrin and platelet aggregation. The defect in aggregation was corrected by the addition of exogenous ERp57, implicating surface ERp57 in platelet aggregation. PMID: 24030382
  48. the V740L polymorphism defines a new low-frequency antigen implicated in two cases of fetomaternal alloimmune thrombocytopenia in a single family PMID: 23305224
  49. Integrin alphaIIbbeta3 was fully activated, independent of the morphological state of human platelets. PMID: 23571313
  50. These results demonstrate that serine/threonine phosphatases, probably PP2A, regulate both inside-out and outside-in mechanisms of signal transduction and clot retraction through Platelet Glycoprotein GPIIb-IIIa Complex in human platelets. PMID: 24096143
  51. The activation capacity of integrin alphaIIbbeta3 integrin was diminished in myelodysplastic syndrome platelets. PMID: 23382103
  52. higher prevalence of PLA2 polymorphism of platelet glycoprotein GPIIa/IIIb in venous thromboembolism(VTE) patients is indicative of the impact of this polymorphism in the pathogenesis of VTE in this population PMID: 23358226
  53. The Leu33Pro polymorphism of IIb/IIIa does not affect the extent of inhibition of platelet aggregation by the IIb/IIIa inhibitors. PMID: 23412353
  54. A GP1BA exon 2 fragment spanned the HPA-2 polymorphism and adjacent sequences. PMID: 23750933
  55. These results identify a novel pathway of integrin alphaIIbbeta3 outside-in signaling and recognize the tyrosine kinase Pyk2 as a major regulator of platelet adhesion and spreading on fibrinogen. PMID: 23216754
  56. A dual mechanism of alphaIIb-beta3 inactivation via calpain(-2) cleavage of integrin-associated proteins and via TMEM16F-dependent phospholipid scrambling with an assistant role of mPTP formation. PMID: 23519467
  57. PPP1C isoforms have distinct contribution to the outside-in alphaIIbbeta3 signalling-dependent functions in HEK293 alphaIIbbeta3 cells. PMID: 23197154
  58. This review focuses on the biology of integrin alphaIIbbeta3, the major membrane protein on blood platelets. PMID: 23580774
  59. These findings suggest an association between AVF thrombosis and the HPA-3b allele, and it is likely that HPA-3 a/b polymorphisms could be useful markers for potential risk of native AVF thrombosis in HD patients. PMID: 22880801
  60. The Cab3(a+) polymorphism is a new rare alloantigen (allelic frequency <1%) carried by alphaIIb that might result in severe life-threatening thrombocytopenias. PMID: 22738334
  61. PI3K/Akt signaling is utilized by alphaIIb-mediated outside-in signaling to activate platelets. PMID: 23082158
  62. the PI3 kinase/Rap1 pathway is intrinsically impaired in platelets from JAK2V617F-positive essential thrombocythemia patients, resulting in diminished thrombin and thrombopoietin-mediated integrin alpha(IIb)beta(3) activation PMID: 23243278
  63. Agonist stimulation, talin-1, and kindlin-3 are crucial for alpha(IIb)beta(3) activation in a human megakaryoblastic cell line, CMK. PMID: 23022222
  64. analysis of Itga2b regulation at the onset of definitive hematopoiesis and commitment to differentiation PMID: 22952660
  65. Low concentration sclerosants activated platelets and released microparticles but inhibited platelet aggregation due to suppression of GPIIb/IIIa activation. PMID: 22531012
  66. Vascular morphogenesis is mediated by integrin 2beta1 trafficking and GSK3beta activity. PMID: 22855295
  67. These results suggested that platelet associated anti-alphaIIbbeta3 antibodies in primary primary immune thrombocytopenia tended to recognize highly restricted regions of alphaIIb with clonality. PMID: 22730538
  68. Family 1 was identified with c.1878G>C and family 2 with c.1787T>C substitution. While the c.1787T>C mutation causes a single amino acid substitution p.I565T, the c.1878G>C mutation (p.Q595H) is predicted to induce a mRNA splicing anomaly. PMID: 22513797
  69. Recurrent mutations of ITGA2B is associated with Glanzmann thrombasthenia. PMID: 22190468
  70. identified alphaIIbbeta3 integrin as a functional galectin-1 receptor in platelets PMID: 22456341
  71. We propose a new inside-out activation mechanism for integrin alpha(IIb)beta(3) and by inference, all of the integrins in their native cellular environment. PMID: 22613710
  72. Human neutrophil alpha-defensins induce formation of fibrinogen and thrombospondin-1 amyloid-like structures and activate platelets via glycoprotein IIb/IIIa. PMID: 22268819
  73. describe the generation of sCD154 mutants that lost their ability to bind CD40 or alphaIIbbeta3 and show that CD154 residues involved in its binding to CD40 or alphaIIbbeta3 are distinct from those implicated in its interaction to alpha5beta1 PMID: 22461623
  74. kindlins do not promote initial talin recruitment to alphaIIbbeta3, suggesting that they co-activate integrin through a mechanism independent of recruitment PMID: 22457811
  75. Disease duration of atopic myelitis is reflected in significantly higher GP IIb/IIIa values than in controls and involves the sensory system, with increased platelet aggregative function. PMID: 22484027
  76. In patients with DES, who require cessation of clopidogrel before surgery, bridging with GP IIb/IIIa inhibitors appears effective in preventing adverse cardiac outcomes but may be associated with bleeding in patients undergoing cardiac surgery. PMID: 22448399
  77. A mutation in the beta3 cytoplasmic tail causes variant Glanzmann thrombasthenia by abrogating transition of alphaIIb beta3 to an active state. PMID: 22136613
  78. Disulfide bonds in EGF domains of beta3 affect structure and function of alphaIIbbeta3 and alphavbeta3 integrins in different manner. PMID: 22308022
  79. Direct intracoronary bolus injection resulted in a more pronounced local inhibition of platelet function and a higher degree of GP IIb/IIIa receptor occupancy as compared to standard intravenous bolus injection. PMID: 22015616
  80. we show that while wild-type kindlin-2 is capable of promoting integrin alpha2b/beta3 activation PMID: 22078565
  81. Studies indicate that mutations increase the activation state of alphaIIbbeta3 and interfere with megakaryocytopoiesis. PMID: 22102273
  82. designed mutations at interface between alphaIIb-subunit thigh domain and beta3-subunit I-EGF2 domain to determine effect of this interface during integrin inside-out activation and outside-in signaling PMID: 21966982
  83. We now look at the repertoire of ITGA2B and ITGB3 gene defects, reexamine the relationship between phenotype and genotype, and review integrin structure in the many variant forms. PMID: 21917754
  84. all carriers of the French Gypsy mutation c.1544+1G>A at intron 15 descended from a common ancestor 300-400 years ago. PMID: 21487445
  85. Intact alphaIIbbeta3 integrin is extended after activation PMID: 21832081
  86. Only the threonine 410 gets dephosphorylated, possibly in an integrin aIIbb3-dependent manner PMID: 21645497
  87. GPIIb/IIIa is the primary receptor set involved in platelet adhesion to adsorbed fibrinogen and serum albumin irrespective of their degree of adsorption-induced unfolding, while the GPIb-IX-V receptor complex plays an insignificant role. PMID: 21529934
  88. identified a novel, conserved heterozygous ITGA2B R995W mutation in 4 unrelated families with congenital macrothrombocytopenia. The surface expression of platelet alphaIIbbeta3 was decreased to 50% to 70% of control. PMID: 21454453
  89. Data show that PLT adhesion to HIMEC was ICAM-1, FKN and integrin alpha(v)beta(3) dependent. PMID: 20158572
  90. analysis of Ca2+-CIB1 and Mg2+-CIB1 and their interactions with the platelet integrin alphaIIb cytoplasmic domain PMID: 21388953
  91. alphaIIbA477P (A446P) mutation distinctly reduces the expression of alphaIIbbeta3 complex on the membrane PMID: 19734576
  92. Glanzmann thrombasthenia causing mutation in ITGA2B highlights the importance of calcium binding domains in the beta-propeller for intracellular trafficking of alphaIIbbeta(3). PMID: 21029361
  93. These data provide important quantitative and qualitative characteristics of alphaIIbbeta3-fibrinogen binding and unbinding that underlie the dynamics of platelet adhesion and aggregation in blood flow. PMID: 21190668
  94. A new low-frequency alloantigen results from the Ser472Asn substitution in alphaIIb. This polymorphism has a limited effect, if any, on the alphaIIbbeta3 complex functions. PMID: 20723174
  95. Data show that the alphaIIb cytoplasmic domain is largely disordered, but it interacts with and influences the conformation of the beta3 cytoplasmic domain. PMID: 21156831
  96. The alphaIIbbeta3 deficiency of the proband was caused by two compound ITGA2B mutations, which were first reported in Chinese Glanzmann thrombasthenia patients. PMID: 20819594
  97. Streptococcus gordonii binding to the alpha(IIb)beta(3)/FcgammaRIIa integrin/ITAM signaling complex results in platelet activation that likely contributes to the thrombotic complications of infective endocarditis. PMID: 21071690
  98. results presented here strongly suggest that MMP-2 interacts with alpha(IIb)beta(3) to regulate the shedding of CD40L exposed on the surfaces of activated human platelets PMID: 20230421
  99. two orthogonal events regulate integrin alphaIIbbeta3's interactions with fibrinogen PMID: 20828133
  100. Presented is an analysis of the nature of the platelet proteins identified as integrin alpha 2b interactors by LC-MS/MS. PMID: 20486118

Show More

Hide All

Involvement in disease Glanzmann thrombasthenia (GT); Bleeding disorder, platelet-type 16 (BDPLT16)
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Integrin alpha chain family
Tissue Specificity Isoform 1 and isoform 2 are expressed in platelets and megakaryocytes, but not in reticulocytes. Not detected in Jurkat, nor in U937 cell lines (PubMed:2351656). Isoform 3 is expressed in prostate adenocarcinoma, as well as in several erythroleukemia, pro
Database Links

HGNC: 6138

OMIM: 187800

KEGG: hsa:3674

STRING: 9606.ENSP00000262407

UniGene: Hs.411312

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1