Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial

In Stock
Code CSB-EP2286HU
Abbreviation Recombinant Human ITIH3 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ITIH3
Uniprot No.
Research Area
Others
Alternative Names
(ITI heavy chain H3)(ITI-HC3)(Inter-alpha-inhibitor heavy chain 3)(Serum-derived hyaluronan-associated protein)(SHAP)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
512-651aa
Target Protein Sequence
MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human ITIH3 protein expression involves the transfection of e.coli cells with a DNA expression vector containing the gene encoding the protein of interest (512-651aa). Following transfection, the cells are cultured to induce the expression of the desired protein. The protein is equipped with a N-terminal 10xHis-GST tag and C-terminal Myc tag. The recombinant Human ITIH3 protein is collected and purified from the cell lysate through affinity purification, achieving a purity greater than 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
Gene References into Functions
  1. ITIH3 rs2535629 SNP was genotyped in N=256 patients receiving various antipsychotics for up to 26weeks. Study found no association of genotype with overall changes in Brief Psychiatric Rating Scale scores, but greater improvement of negative symptoms in minor allele carriers indicates that rs2535629 may help to identify a subset of schizophrenia patients with better treatment response to clozapine. PMID: 27396837
  2. confirmed the association of schizophrenia with ITIH3/4 in a Han Chinese population PMID: 26206863
  3. A novel association between suicide attempt and the ITIH3/4-region in a combined group of patients with bipolar disorder, schizophrenia and related psychosis spectrum disorders. PMID: 24461634
  4. Study showed the association of a polymorphism (rs2535629) of ITIH3 with psychiatric disorders in an Asian population and that rs2535629 influences the susceptibility to psychiatric disorders by affecting the expression level of GLT8D1 PMID: 24373612
  5. This study demonistrated that Genome-wide significant associations in schizophrenia to ITIH3/4 and extensive replication of associations reported by the Schizophrenia. PMID: 22614287
  6. ITIH3 protein was found to be more highly expressed in plasma of tumor bearing mice compared to control. PMID: 20515073
  7. ITIH3 single-nucleotide polymorphism is a novel genetic risk factor of myocardial infarction. PMID: 17211523
  8. Widespread heavy chain 3 was only present in urinary stone formers PMID: 17898697

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
ITIH family
Database Links

HGNC: 6168

OMIM: 146650

KEGG: hsa:3699

STRING: 9606.ENSP00000415769

UniGene: Hs.76716

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*