Recombinant Human Interleukin-32 (IL32)

Discontinued
Code CSB-YP011655HU
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
IL32
Uniprot No.
Research Area
Cytokine
Alternative Names
Natural killer cells protein 4Tumor necrosis factor alpha-inducing factor
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
31-234aa
Target Protein Sequence
AWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-sumostar-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
25-35 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.
Gene References into Functions
  1. IL-32gamma functions as intracellular effector in hepatocytes for suppressing hepatitis b virus replication. PMID: 30115930
  2. Results indicate that interleukin-32 gamma (IL-32gamma) plays a protective role for bone loss, providing clinical evidence of a negative correlation between IL-32gamma and DKK1 (Dickkopf-1) as bone metabolic markers. PMID: 28079119
  3. Our study shows a functional effect of a promoter single-nucleotide polymorphism (SNP) in IL32 on lipid profiles in RA patients and individuals, suggesting a possible protective role of this SNP against CVD. PMID: 28134327
  4. IL-32 may be an important pro-inflammatory molecule involved in calcific aortic valve disease. PMID: 29748157
  5. High IL32 expression is associated with hepatocellular carcinoma. PMID: 29286122
  6. Strong expression of IL-32 was detected in cardiomyocytes from heart failure patients. PMID: 28747035
  7. The increase in serum levels of IL-32 in accordance with additive effect of the presence of C allele in Multiple sclerosis patients might introduce IL-32 as a key player in MS pathogenesis or immunedysregulation PMID: 28716229
  8. high expression of both IL17A and IL32 leads to enhancement of T cell responses in breast tumors PMID: 28470472
  9. In transgenic mice, the presence of IL-32gamma contributes to the lesion healing caused by Leishmania braziliensis but not by Leishmania amazonensis. PMID: 28709468
  10. High IL32 expression is associated with lung metastasis in melanoma. PMID: 27589563
  11. In Kaposi sarcoma (KS) splicing ratio of the IL-32 isoforms showed IL-32gamma as the highest expressed isoform, followed by IL-32beta, in HIV-related KS cases compared with controls. Our data suggest a possible survival mechanism by the splicing of IL-32gamma to IL-32beta and also IL-6, IL-8, and CXCR1 signaling pathways to reverse the proapoptotic effect of the IL-32gamma isoform, leading to tumor cell survival and th... PMID: 29037857
  12. Three single nucleotide polymorphisms (SNPs) (rs28372698, rs12934561, rs4786370) of the IL32 gene have been proposed as modifiers for different diseases. The present study found no significant differences in the genotypic frequencies between the patients and healthy controls and no relation to survival for any of the SNPs. PMID: 29277790
  13. This study showed that the induction level of IL-32 was increased in chronic rhinosinusitis with nasal polyps compared to normal nasal mucosa and that LPS-induced IL-32 expression in nasal polyp-derived fibroblasts was regulated via the TLR4/JNK/AKT/CREB signaling pathway. PMID: 27173130
  14. findings show that IL-32alpha acts on NK cells to inhibit IL-15-mediated STAT5 phosphorylation and to suppress their IL-15-induced effector molecule expression and cytolytic capacity. IL-32alpha also acted on DCs by downregulating IL-15-induced IL-18 production, an important cytokine in NK cell activity. PMID: 28701509
  15. Thus, endogenous IL-32 is a crucial cytokine involved in the host defense against Leishmania parasites. PMID: 28241012
  16. Study indicated the overexpression of IL-32 in induced sputum of smokers and chronic obstructive pulmonary disease (COPD) patients, which was correlated with smoking exposure index and the degree of airway obstruction. It demonstrated that IL-32 might play critical role in smokers with COPD. PMID: 24761997
  17. this study shows that IL-32 might be involved in the pathogenesis of hepatic fibrosis by inducing TIMP-1 expression PMID: 27302771
  18. serum levels of IL-32 and TNF-alpha may be diagnostic markers, and serum IL-29 levels may be associated with good prognosis in patients with gastric cancer PMID: 26219901
  19. the importance of IL-32 polymorphism and mRNA expression in susceptibility and influence of survival status in lung cancer PMID: 27775437
  20. Data identify interleukin-32 (IL-32) as a potential therapeutic target. PMID: 26978598
  21. Low IL-32 expression is associated with colon cancer. PMID: 26824417
  22. Results show low plasma IL-32 levels in patients with systemic lupus erythematosus (SLE) and the rs28372698 SNP was associated with the susceptibility to SLE suggesting a possible role as a candidate marker to monitor SLE disease stability and screening in future. PMID: 27069296
  23. High IL32 expression is associated with acute myeloid leukemia. PMID: 26516703
  24. highlight some of the potential mechanisms by which the immunomodulatory effect of IL-32 occurs against mycobacterial infections but also areas where mechanistic clarifications are needed PMID: 26144292
  25. Additional IL-32gamma stimulation in precursor cells enhanced osteoblast differentiation potentially PMID: 26634249
  26. This study demonstrates that IL-32gamma and IL-32beta can induce caspase-8-dependent cell death whereas this was not observed for IL-32alpha PMID: 26678222
  27. High IL32 expression is associated with Sezary syndrome. PMID: 26551670
  28. soluble IL-6R expression upregulated the levels of its own ligand, IL-6 and those of the pro-inflammatory cytokine IL-32. PMID: 25176527
  29. Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure PMID: 26241657
  30. These results suggest that IL-32beta could activate NF-kappaB and STAT3, and thus affect neuroinflammation as well as amyloidogenesis, leading to worsening memory impairment. PMID: 25159479
  31. IL-32 is involved in the pathogenesis of airway inflammation. PMID: 26151454
  32. High IL-32 expression may stimulate the organic metastasis and the lymph node metastasis of colorectal cancer. PMID: 25889282
  33. data further confirms that reduced IL32 methylation is associated with JIA, and that SNPs play an interactive role PMID: 26057774
  34. IL-32alpha can prevent cerebral ischemia damage via STAT3 activation and inhibition of NF-kappaB activation. PMID: 24854197
  35. In IL-32alpha-Tg mice, azoxymethane-induced colon cancer incidence was decreased, but expression of TNFR1 and TNFR1-mediated apoptosis was increased. IL-32alpha increased ROS production, prolonging JNK activation. In colon cancer patients, IL-32alpha was increased. PMID: 25909160
  36. IL-32 stimulation promotes the invasion and motility of osteosarcoma cells, possibly via the activation of AKT and the upregulation of MMP-13 expression. PMID: 25846944
  37. The anti-Mycobacterium tuberculosis effects of IL-32gamma are mediated through classical caspase-3-dependent apoptosis as well as caspase-3-independent apoptosis. PMID: 25887904
  38. IL-32 gamma delays, in a dose-dependent manner, the spontaneous apoptosis of human blood neutrophils by activating mainly p38 MAPK through rapid p38 phosphorylation. PMID: 25275312
  39. we demonstrate that the newly discovered isoform, IL-32theta;, suppresses monocyte differentiation by regulating the expression of the PU.1 transcription factor. PMID: 25726525
  40. This study demonstrates that IL-32 gene polymorphisms are significantly associated with increased endometrial cancer susceptibility in Chinese Han women PMID: 25663496
  41. These results suggest that IL-32gamma enhances an innate immune response against local infection but inhibits the spread of immune responses, leading to systemic immune disorder. PMID: 24743568
  42. Transgenic mice that express human interleukin-32 are protected from high-fat diet-induced hepatic steatosis. PMID: 25645248
  43. overexpression of IL-32gamma contributes to initial islet beta-cells injury and inflammation in pancreas and aggravates streptozotocin-induced type 1 diabetes. PMID: 25022955
  44. IL32 may play a unique role in mycosis fungoides progression as an autocrine cytokine PMID: 24938282
  45. Our results clearly suggest that IL-32 is an important mediator for gastric cancer metastasis and independent prognostic predictor of gastric cancer. PMID: 24602839
  46. The Epstein-Barr virus LMP1-induced IL-32 traps protein kinase Cdelta in the cytoplasm and prevents it from binding to the Zta promoter, which is the key event for virus activation. PMID: 25810549
  47. IL-32theta;, through its interaction with PKCdelta, downregulates CCL5 expression by mediating the phosphorylation of STAT3 on Ser727 to render it transcriptionally inactive. PMID: 25280942
  48. IL-32gamma enhances host immunity to Mycobacterium tuberculosis. PMID: 25820174
  49. IL-32alpha inhibits BCL6 SUMOylation by activating PKCepsilon, resulting in the modulation of BCL6 target genes and cellular functions of BCL6. PMID: 25245533
  50. IL-32gamma prevents ethanol-induced hepatic injury via the inhibition of oxidative damage and inflammatory responses. PMID: 25583360

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Selectively expressed in lymphocytes. Expression is more prominent in immune cells than in non-immune cells.
Database Links

HGNC: 16830

OMIM: 606001

KEGG: hsa:9235

UniGene: Hs.943

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*