Recombinant Human Keratin, type II cytoskeletal 7(KRT7)

Code CSB-EP012564HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P08729
Relevance Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cytokeratin-7 Short name: CK-7 Keratin-7 Short name: K7 Sarcolectin Type-II keratin Kb7
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Research Area Signal Transduction
Source E.coli
Gene Names KRT7
Protein Names Recommended name: Keratin, type II cytoskeletal 7 Alternative name(s): Cytokeratin-7 Short name= CK-7 Keratin-7 Short name= K7 Sarcolectin Type-II keratin Kb7
Expression Region 2-469aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 67.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Subcellular Location Cytoplasm
Protein Families Intermediate filament family
Tissue Specificity Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
Database Links

HGNC: 6445

OMIM: 148059

KEGG: hsa:3855

STRING: 9606.ENSP00000329243

UniGene: Hs.411501

Related Products

KRT7 Antibodies

KRT7 Antibodies for Homo sapiens (Human)

KRT7 Antibodies for Human

KRT7 Proteins

KRT7 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.