Recombinant Human Keratin, type II cytoskeletal 7 (KRT7)

In Stock
Code CSB-EP012564HU
Abbreviation Recombinant Human KRT7 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
KRT7
Uniprot No.
Research Area
Signal Transduction
Alternative Names
CK 7; CK-7; CK7; Cytokeratin 7; Cytokeratin-7; D15Wsu77e; K2C7; K2C7_HUMAN; K7; Keratin 7; Keratin 7; type II; Keratin type II cytoskeletal 7; Keratin; 55K type II cytoskeletal; Keratin; simple epithelial; Keratin; simple epithelial type I; K7; Keratin; type II cytoskeletal 7; Keratin-7; Krt2-7; KRT7; MGC11625; MGC129731; MGC3625; Sarcolectin; SCL; Type II mesothelial keratin K7; Type-II keratin Kb7
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-469aa
Target Protein Sequence
SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
67.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Gene References into Functions
  1. Data indicate that de novo expression of KRT7 and KRT19 resulting in altered plasticity and stem cell characteristics of epithelial cells might be a crucial factor in increasing the risk of tumor development in end-stage kidneys. PMID: 30194170
  2. High expression of CK-7 is associated with intrahepatic cholangiocarcinoma. PMID: 29513894
  3. Positive expression of CK7 associated with pathological features of lymph node metastasis and T stage may be independent clinical parameters for poor prognosis of patients with lung cancer. PMID: 28827446
  4. Research show that circulating CK7 mRNA positive cells were found in patients with bladder urothelial cancer of varying stages, and the detection rates increased with stage predicting worse clinical scenario. PMID: 28024950
  5. CK7/ HPV-L1 expression, and the presence of koilocytosis can be used for prognostication in patients with cervical low-grade squamous intraepithelial lesions. PMID: 28554573
  6. KRT7-AS formed an RNA-RNA hybrid with KRT7 and controlled KRT7 expression at both the mRNA and the post-transcriptional levels. forced overexpression of the KRT7-overlapping region (OL) of KRT7-AS (but not its non-KRT7-OL portions) increased keratin 7 protein levels in cells. Finally, forced overexpression of full-length KRT7-AS or OL KRT7-AS (but not its non-KRT7-OL regions) promoted GC cell proliferation PMID: 26876208
  7. These data support the theory that CK7 staining may inform risk stratification for low-grade squamous intraepithelial cervical lesions (CIN1). PMID: 27680604
  8. the status of K7 expression in metastatic lymph nodes from colorectal carcinoma is a poor prognostic factor PMID: 28155971
  9. Mismatch repair (MMR) defects influence the expression of clinically important biomarkers for endometrioid-type endometrial carcinoma as decreased cytokeratin 7 expression is more commonly associated with MMR deficiency. PMID: 25851713
  10. Ischemic parenchymal changes are characterized by hepatocyte K7 immunoexpression PMID: 26887669
  11. Survival analysis showed that the non-small cell lung carcinoma patients with enhanced expression of CK7, ELF3, EGFR, and EphB4 mRNA in peripheral blood leukocytes had poorer disease-free survival and overall survival than those without. PMID: 27827952
  12. Keratin 34betaE12/K7 expression is a prognostic parameter in resected early stage NSCLC that allows identification of high-risk NSCLC patients with poor cancer-specific and overall survival. PMID: 26057535
  13. K7 expression was also detected in 72 of 75 triple-negative carcinoma cases PMID: 26670478
  14. CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed. PMID: 26469326
  15. CK7 staining was notably heterogeneous, with 14.5% of all cases demonstrating PMID: 22748158
  16. Data show that cytokeratin-7 (KRT7) mRNA expression serves as a sensitive approach for the molecular detection of KRT7-positive circulating tumour cells (CTCs)-resembling A549 cells in peripheral whole blood. PMID: 26306784
  17. Cytokeratin 7 positivity in cervical low-grade squamous intraepithelial lesion is a marker for risk of progression to a high-grade lesion. PMID: 26551618
  18. Immunostaining for CK7 and epithelial membrane antigen can be used to differentiate interlobular bile ducts from ductular proliferation in patients with cholestasis. PMID: 26366614
  19. Epithelial-mesenchymal transition-related proteins CK-7 and alpha-SMA colocalized to the intrahepatic biliary epithelial cells in patients with biliary atresia. PMID: 25406900
  20. The immunofluorescent staining pattern of Wnt1 and CK7 as well as Wnt1 and CK13 was consistent with IHC results. Thus, in pleomorphic adenoma, Wnt is involved in tumor cell differentiation of peripheral columnar cells forming solid nests PMID: 25076852
  21. The present study confirmed that CK14, but not CK20 or CK7, is expressed in urothelial carcinoma with squamous differentiation and squamous cell carcinoma of the urinary bladder. PMID: 25643514
  22. Our results suggested that a combination of CK7 and TP53 immunohistochemistry may be helpful in diagnosing inflammatory bowel disease-associated dysplasia in difficult cases. PMID: 23887291
  23. BRAF-mutated microsatellite stable colorectal carcinoma often displays reduced CDX2 and increased CK7 expression PMID: 24908142
  24. Loss of cytokeratin 7 is associated with reduced response to concommitant radiochemotherapy for locally advanced cervical cancer. PMID: 24403459
  25. CK7 and Cam 5.2 expression may occur in SCC. A panel including Ber-Ep4 is advisable for immunohistochemical differentiation of EPD from SCC. PMID: 23590728
  26. Of the cases of clear cell renal carcinoma there was immunoreactivity for alpha-methylacyl-CoA racemase and strong diffuse immuno-positivity for cytokeratin. PMID: 23434146
  27. CK7 + centrilobular hepatocytes occur relatively frequently in non-neoplastic liver disease, associated with centrilobular scarring and CK7-positive periportal hepatocytes, and appear to be a non-specific phenomenon of underlying disease. PMID: 22716237
  28. Heterogeneity of cytokeratin 7 expression in pagetoid Bowen's disease. PMID: 22390404
  29. Pouch/peripouch and UC-associated adenocarcinoma had a comparable positive rate for CK7, CK20, and CDX2 by immunohistochemistry. PMID: 22895272
  30. High Cytokeratin-7 is associated with esophageal squamous cell carcinoma. PMID: 22203179
  31. Both the CK7-/CK20+ phenotype and expression of the antibody CDX2 are highly specific and sensitive markers of colorectal origin. PMID: 22268990
  32. This is the first reported study of the relationship between CK20/CK7 immunophenotype, BRAF mutations and microsatellite status in colorectal carcinomas PMID: 22361037
  33. None of the Wilms' tumors-associated lesions were positive for KRT7, but 69-80% of lesions associated with pRCpapillary renal cell tumors and mucinous tubular and spindle cell carcinomas were positive for KRT7. PMID: 22382985
  34. The expressions of CK7 and CK20 in nasal polyps were analyzed. PMID: 22119824
  35. Aberrant expression of K7 in budding cancer cells represents a modification of the epithelial phenotype ('epithelial-epithelial transition': EET) which may be linked to gains in motility and invasive potential. PMID: 21884201
  36. CK-7 expression grades correlated positively with histological stages of primary biliary cirrhosis (r=0.639, P<0.000) and negatively with granulomas (r=-0.432, P<0.0001; OR=0.173, P=0.0011). PMID: 21681009
  37. Our results reveal that menopause influences the adipose tissue expression of many genes, especially of neurexin 3, metallothionein 1E, and keratyn 7, which are associated with the alteration of several key biological processes. PMID: 21358552
  38. Our results along with the data from the literature indicate that CK7/CK20 expression may be of clinical significance. PMID: 21574103
  39. Case Report: Primary pulmonary adenocarcinoma with enteric differentiation resembling metastatic colorectal carcinoma, negative for cytokeratin 7. PMID: 20727680
  40. A considerable number of colorectal carcinomas showed immunoreactivity to CK7. PMID: 21282015
  41. Hepatocyte CK7 expression is frequently noted in chronic allograft rejection, and it would appear to reflect ductopenia. PMID: 21228364
  42. Immunohistochemistry for cytokeratins 7 and 19, which mark biliary epithelium, is helpful in the diagnosis of biliary diseases. PMID: 20538416
  43. Endometrial adenocarcinomas show micro-anatomical variations in Ki67 expression and this is often inversely correlated with CK7 immunoreactivity. PMID: 20557372
  44. Case Report: CK7+/CK20- Merkel cell carcinoma presenting as inguinal subcutaneous nodules with subsequent epidermotropic metastasis. PMID: 20574624
  45. the expression of Cytokeratins 7, 8, 18, and 19 may serve as differential diagnostic markers for pulmonary large cell neuroendocrine carcinoma and small cell lung carcinoma PMID: 20398190
  46. CK7 is a possible marker for colorectal carcinogenesis. PMID: 17715023
  47. FOXA1 induces not only KRT7 but also LOXL2 in a subset of poor prognostic esophageal squamous cell carcinomas with metastatic lymph nodes PMID: 20043065
  48. Toker cells and mammmary Paget cells share immunoreactivity to CK7. PMID: 20001343
  49. Changing pattern of cytokeratin 7 and 20 expression from normal epithelium to intestinal metaplasia of the gastric mucosa and gastroesophageal junction PMID: 11962749
  50. HPV16 E7 mRNA-cytokeratin 7 binding in squamous cervical cancer SiHa cells occurs through the 6-mer peptide SEQIKA present in human cytokeratin 7 protein PMID: 12072504

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Intermediate filament family
Tissue Specificity
Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
Database Links

HGNC: 6445

OMIM: 148059

KEGG: hsa:3855

STRING: 9606.ENSP00000329243

UniGene: Hs.411501

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*