CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-EP843276HU |
Size | US$1726 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | AADAT |
Uniprot No. | Q8N5Z0 |
Research Area | Signal Transduction |
Alternative Names | 2 aminoadipate aminotransferase; 2 aminoadipate transaminase; 2-aminoadipate aminotransferase; 2-aminoadipate transaminase; Aadat; AADAT_HUMAN; Aadt; AI875679; Alpha aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; Aminoadipate aminotransferase; EC 2.6.1.39; EC 2.6.1.7; KAT/AadAT; KAT2; KATII ; Kynurenine oxoglutarate transaminase 2; Kynurenine aminotransferase II; Kynurenine oxoglutarate aminotransferase II; Kynurenine oxoglutarate transaminase II; Kynurenine--oxoglutarate aminotransferase II; Kynurenine--oxoglutarate transaminase II; Kynurenine/alpha-aminoadipate aminotransferase mitochondrial [Precursor]; Kynurenine/alpha-aminoadipate aminotransferase; mitochondrial; L kynurenine/alpha aminoadipate aminotransferase |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 30-425aa |
Target Protein Sequence | PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 60.2kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Function | Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro). |
Gene References into Functions |
|
Subcellular Location | Mitochondrion |
Protein Families | Class-I pyridoxal-phosphate-dependent aminotransferase family |
Tissue Specificity | Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary. |
Database Links |
HGNC: 17929 OMIM: 611754 KEGG: hsa:51166 STRING: 9606.ENSP00000226840 UniGene: Hs.529735 |