Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial(AADAT)

Code CSB-EP843276HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names AADAT
Uniprot No. Q8N5Z0
Research Area Signal Transduction
Alternative Names 2 aminoadipate aminotransferase; 2 aminoadipate transaminase; 2-aminoadipate aminotransferase; 2-aminoadipate transaminase; Aadat; AADAT_HUMAN; Aadt; AI875679; Alpha aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; Aminoadipate aminotransferase; EC 2.6.1.39; EC 2.6.1.7; KAT/AadAT; KAT2; KATII ; Kynurenine oxoglutarate transaminase 2; Kynurenine aminotransferase II; Kynurenine oxoglutarate aminotransferase II; Kynurenine oxoglutarate transaminase II; Kynurenine--oxoglutarate aminotransferase II; Kynurenine--oxoglutarate transaminase II; Kynurenine/alpha-aminoadipate aminotransferase mitochondrial [Precursor]; Kynurenine/alpha-aminoadipate aminotransferase; mitochondrial; L kynurenine/alpha aminoadipate aminotransferase
Species Homo sapiens (Human)
Source E.coli
Expression Region 30-425aa
Target Protein Sequence PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 60.2kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
Gene References into Functions
  1. Immunohistochemical analysis revealed the presence of KAT I, II, and III in all examined corneal sections. PMID: 28706436
  2. he optimised method of protein production provides a fast and reliable technique to generate large quantities of active human KAT2 suitable for future small-molecule lead compound screening and structural design work. PMID: 26773745
  3. Participants with major depression had lower levels of kynurenine compared to controls, with intermediate concentrations in somatoform patients. PMID: 24140252
  4. Somatization is characterized by disorders in kynurenine aminotransferase activity and an increased neurotoxic potential PMID: 21712776
  5. association of SNP AADAT+401C/T with the host immune response to bacterial meningitis, suggesting that this SNP may affect the host ability in recruitment of leukocytes to the infection site PMID: 21473761
  6. analysis of the crystal structure of kynurenine aminotransferase II PMID: 18056995
  7. analysis of the crystal structure of human kynurenine aminotransferase II PMID: 18056996
  8. A human cDNA encodes a 425-residue protein with a mitochondrial cleavage signal and a pyridoxal-phosphate binding site, ~70% identical to the mouse and rat AADAT orthologs. Bacterial expression studies confirm that the gene encodes AADAT activity. PMID: 12126930

Show More

Hide All

Subcellular Location Mitochondrion
Protein Families Class-I pyridoxal-phosphate-dependent aminotransferase family
Tissue Specificity Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.
Database Links

HGNC: 17929

OMIM: 611754

KEGG: hsa:51166

STRING: 9606.ENSP00000226840

UniGene: Hs.529735

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1