Recombinant Human L-amino-acid oxidase (IL4I1), partial, Biotinylated

In Stock
Code CSB-EP850426HU2-B
Abbreviation Recombinant Human IL4I1 protein, partial, Biotinylated
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Interleukin-4-induced protein 1;Protein Fig-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
357-567aa
Target Protein Sequence
LSFRRPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASYTWSDAAAAFAGLSREEALRLALDDVAALHGPVVRQLWDGTGVVKRWAEDQHSQGGFVVQPPALWQTEKDDWTVPYGRIYFAGEHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVASSPSHDLAKEEGSHPPVQGQLSLQNTTHTRTSH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
70.9 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secreted L-amino-acid oxidase that acts as a key immunoregulator. Has preference for L-aromatic amino acids: converts phenylalanine (Phe), tyrosine (Tyr) and tryptophan (Trp) to phenylpyruvic acid (PP), hydroxyphenylpyruvic acid (HPP), and indole-3-pyruvic acid (I3P), respectively. Also has weak L-arginine oxidase activity. Acts as a negative regulator of anti-tumor immunity by mediating Trp degradation via an indole pyruvate pathway that activates the transcription factor AHR. IL4I1-mediated Trp catabolism generates I3P, giving rise to indole metabolites (indole-3-acetic acid (IAA) and indole-3-aldehyde (I3A)) and kynurenic acid, which act as ligands for AHR, a ligand-activated transcription factor that plays important roles in immunity and cancer. AHR activation by indoles following IL4I1-mediated Trp degradation enhances tumor progression by promoting cancer cell motility and suppressing adaptive immunity. Also has an immunoregulatory function in some immune cells, probably by mediating Trp degradation and promoting downstream AHR activation: inhibits T-cell activation and proliferation, promotes the differentiation of naive CD4(+) T-cells into FOXP3(+) regulatory T-cells (Treg) and regulates the development and function of B-cells. Also regulates M2 macrophage polarization by inhibiting T-cell activation. Also has antibacterial properties by inhibiting growth of Gram negative and Gram positive bacteria through the production of NH4(+) and H2O2.
Gene References into Functions
  1. the presence of IL4I1 during T-cell activation decreases early signaling events downstream of t-cell receptor stimulation, resulting in global T-cell inhibition which is more pronounced when there is CD28 costimulation. PMID: 28891065
  2. Data showed proteome changes in alveolar epithelial cells type II exposed to an infection with A. fumigatus with IL4I1 showing the most prominent increase in abundance both, in terms of relative abundance as well as activity. Also, in the infected lungs, there was levels of IL4I1 metabolic products. PMID: 28951444
  3. reviewed SNPs of the IL4I1 isoform 1, which is expressed in lymphoid tissue; the N92D SNP leads to a hyperactive enzyme, while the R102G mutation is hypomorphic; show that IL4I1 activity is not only directed against phenylalanine, as initially described, but also at a lower level against arginine PMID: 26673964
  4. The immunosuppressive enzyme IL4I1 expressed differentially in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells. PMID: 25446972
  5. IL4I1 upregulation in human Th17 cells limits their TCR-mediated expansion not only by blocking the molecular pathway involved in the activation of the IL-2 promoter, but also by maintaining high levels of Tob1, which impairs entry into the cell cycle. PMID: 24307243
  6. IL4I1 plays a distinct role compared to other antibacterial enzymes produced by mononuclear phagocytes. PMID: 23355881
  7. participates in the downregulation of Th1 inflammation PMID: 20683900
  8. genomic structure, cDNA sequence, chromosome location and RNA expression in immune tissues PMID: 12031486
  9. is activated in primary mediastinal large B-cell lymphoma, which might be due to a constitutive activation of a cytokine signaling pathway PMID: 12446450
  10. hIL4I1 inhibited the proliferation of CD3-stimulated T lymphocytes with a similar effect on CD4(+) and CD8(+) T cells. In contrast, memory T cells were more strongly affected by hIL4I1 and its catabolite H(2)O(2) than naive T cells PMID: 17356132
  11. strong IL4I1 expression is associated with B-cell lymphomas. PMID: 19436310

Show More

Hide All

Subcellular Location
Secreted. Lysosome. Cytoplasmic vesicle, secretory vesicle, acrosome.
Protein Families
Flavin monoamine oxidase family, FIG1 subfamily
Tissue Specificity
Primarily found in immune tissues, with the highest expression in lymph nodes and spleen. Present in germinal center macrophages and inflammatory myeloid cells and antigen-presenting cells (at protein level). Also present in spermatozoa (at protein level)
Database Links

HGNC: 19094

OMIM: 609742

KEGG: hsa:259307

STRING: 9606.ENSP00000342557

UniGene: Hs.574492

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*