Recombinant Human LIM and SH3 domain protein 1 (LASP1), partial

Code CSB-EP613523HU1
Abbreviation Recombinant Human LASP1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
LASP1
Uniprot No.
Research Area
Transport
Alternative Names
Metastatic lymph node gene 50 protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-243aa
Target Protein Sequence
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.5 kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types.
Gene References into Functions
  1. Data shows that LASP1 is significantly upregulated in breast cancer tissues and cell lines, and its upregulation significantly associated with disease progression. Also, LASP1 was identified as a target gene of miR-133a, and its expression negatively regulated by miR-133a in breast cancer cells. PMID: 29207145
  2. An in vitro study showed that overexpression of miR-133b inhibited the proliferation, migration, and invasion of HepG2 and Hep3B cells. Similarly, knockdown of LASP1 reduced HepG2 and Hep3B cell proliferation, migration, and invasion. PMID: 28117027
  3. Findings indicated that LASP-1, as a downstream target of SOX9, may act as a novel biomarker for lung cancer and plays an important role in cell proliferation, migration, and invasion. PMID: 29138807
  4. miR-203a-3p suppresses tumor growth and metastasis through targeting LASP1 in NPC. PMID: 28982387
  5. LASP1 silencing elicited effects similar to miR-326 overexpression on HCC cells. PMID: 28713953
  6. A combination of low 14-3-3sigma and high LASP1 expression shows a worse trend with overall survival of colorectal cancer patients. PMID: 27156963
  7. Furthermore, we identify flotillin-1 (FLOT1) and histone H1 as downstream factors for cytoplasmic and nuclear pathway of S100A11, which are required for LASP1-S100A11 axis-mediated epithelial-mesenchymal transition and colorectal cancer progression. PMID: 27181092
  8. Overexpression of LASP-1 in thyroid cancer tissues.LASP-1 role in thyroid cancer cell proliferation and invasion.LASP-1 is an oncogene. PMID: 27938497
  9. Study found LASP1 to be downregulated after knockdown of PVT1 and overexpression of LASP1 attenuated the tumor-suppressive roles of PVT1 knockdown in esophageal squamous cell carcinoma. PMID: 28404954
  10. Data indicate that LIM and SH3 protein 1 (LASP1) is a direct target of miR-145. PMID: 27626692
  11. LASP1 enhances the expression and secretion of MMPs, favoring breast cancer cell migration and invasiveness. PMID: 27588391
  12. miR-218 contributes to PE by targeting LASP1 to inhibit trophoblast invasion PMID: 28412444
  13. The correlation between LIM and SH3 domain-containing protein expression levels in cancer and the poor outcome and metastatic behavior of tumors denotes the clinical significance of this protein and hints its potential value as a new cancer prognostic or even diagnostic biomarker PMID: 28621232
  14. LASP-1 contributes to the formation and progression of prostate cancer through a NF-kappaappa B pathway. PMID: 27840958
  15. High expression of miR218 is associated with gastric cancer. PMID: 27696291
  16. LASP-1 may essentially involve in the metastasis and growth of CCA and clinical significance of LASP-1 may reside in function as a biomarker to predict prognosis and as a promising therapeutic strategy for CCA patients by the inhibition of LASP-1 expression PMID: 26729195
  17. It is a target gene of miR-1. PMID: 26414725
  18. LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays PMID: 25982273
  19. LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway. PMID: 26797416
  20. LASP-1, mediated by miR-203, has crucial functions in the proliferation, migration and invasion of human non-small cell lung cancer PMID: 26683818
  21. Detecting an affection of migratory processes after LASP-1 silencing, we propose that LASP-1 could impact on metastasis of CC [choriocarcinoma]cells. PMID: 26232936
  22. Results identified LASP1 as a hitherto unknown protein in melanocytes and as novel partner of dynamin in the physiological process of membrane constriction and melanosome vesicle release. PMID: 26061439
  23. Our results suggest that LASP-1 mRNA overexpression may be mainly implicated in female hepatocellular carcinoma (HCC) and cirrhotic HCCs; and that LASP1 may play its role with vimentin in HCC cells. PMID: 25760690
  24. LASP-1 overexpression was associated with aggressive phenotype in clear cell renal cell cancer. PMID: 24955835
  25. LASP1 plays key roles in cell structure, physiological processes, and cell signaling; overexpression contributes to cancer aggressiveness [review] PMID: 25622104
  26. LIM and SH3 protein 1 induces TGFbeta-mediated epithelial-mesenchymal transition in human colorectal cancer by regulating S100A4 expression. PMID: 25252758
  27. Study revealed that LASP1 phosphorylation results in an association with CRKL - another specific BCR-ABL substrate and bona fide biomarker for BCR-ABL activity. PMID: 24913448
  28. Results defined LASP1 as a direct target gene for HIF1alpha upregulation that is critical for metastatic progression of PDAC. PMID: 25385028
  29. LASP-1, overexpressed in gastric cancer and associated with poor prognosis, plays an important role in the growth and metastasis of gastric cancer. PMID: 24990592
  30. Results show significant upregulation of LASP1 and SCAD protein levels in acute psychotic bipolar disorder samples. PMID: 24554194
  31. LASP1 was a direct target of miR-218 in prostate cells. PMID: 24815849
  32. LASP-1 is linked closely to tumourigenicity in oral cancer. PMID: 24386158
  33. Data indicate decreased cell migratory potential accompanied by enhanced cell adhesion, but no significant inhibition of cell proliferation as measured by in T24 cells upon LIM and SH3 (LASP)-1 protein (LASP-1) knockdown. PMID: 22481019
  34. LASP1 may play an important role in the pathogenesis of esophageal squamous cell carcinoma. PMID: 23254782
  35. Data show that miR-133a can target the 3' untranslated region (3'UTR) of LIM and SH3 protein 1 (LASP1) mRNA and suppress the expression of LASP1. PMID: 23968734
  36. Phosphorylation of LASP-1 by PKA at serine 146 induces translocation of the LASP-1/ZO-2 complex from the cytoplasm to the nucleus. PMID: 22665060
  37. A single-nucleotide polymorphism in the LASP1 gene promoter region is associated with schizophrenia susceptibility. PMID: 23040864
  38. High cytosolic LASP-1 expression is associated with hepatocellular carcinoma. PMID: 23084841
  39. miR-203 inhibits the migration and invasion of esophageal squamous cell carcinoma by regulating LASP1. PMID: 22940702
  40. Up-regulated of BIRC5 and LASP1 was able to abrogate the effects induced by transfection with the miR-203 precursor in triple negative breast cancer. PMID: 22713668
  41. These results demonstrated that hepatitis B virus X protein could upregulate LASP-1 through PI3-K pathway to promote the proliferation and migration of hepatoma cells. PMID: 22897902
  42. Data indicate that LASP1 may have an oncogenic function and that it might be regulated by miR-1, miR-133a, and miR-218, which may function as tumor suppressive miRNAs in bladder cancer (BC). PMID: 20843712
  43. Data indicate that Lasp-1 is a novel component of podosomes and is involved in the regulation of podosomal function. PMID: 22514729
  44. LASP-1 has an essential role in growth and migration of ovarian carcinoma cells, possibly by influencing the localization of zyxin. PMID: 17211471
  45. LASP-1 gene expression enhances proliferation of colorectal cancer cells and may serve as a useful marker for colorectal cancer progression. PMID: 21215099
  46. LASP-1 interaction with CXCR2 is critical for CXCR2-mediated chemotaxis PMID: 20419088
  47. LASP1 knockdown by small interfering RNA-mediated silencing indicates its funcion role in progression and metastasis of medulloblastoma. PMID: 20924110
  48. LASP-1, S100A9 and RhoGDI were detected by proteomic analysis to be differentially expressed between normal mucosa, non-metastatic colorectal carcinoma and metastatic CRC tissue PMID: 20812987
  49. Overexpression of LASP-1 was found in metastatic colorectal cancer (CRC) tissues (p=0.002), and its expression level was closely correlated with overall survival of patients with CRC (p=0.002). PMID: 20660701
  50. Nuclear LASP-1-positivity may serve as a negative prognostic indicator for long-term survival of breast cancer patients. PMID: 20461080

Show More

Hide All

Subcellular Location
Cytoplasm, cell cortex. Cytoplasm, cytoskeleton.
Database Links

HGNC: 6513

OMIM: 602920

KEGG: hsa:3927

STRING: 9606.ENSP00000325240

UniGene: Hs.741156

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*