Recombinant Human LIM domain kinase 1 (LIMK1)

Code CSB-MP012952HU
Abbreviation Recombinant Human LIMK1 protein
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
LIMK-1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-647aa
Target Protein Sequence
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
140.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-HSA-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop. LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton. In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation. Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly. Stimulates axonal outgrowth and may be involved in brain development.; Has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).
Gene References into Functions
  1. Results indicated that LIM kinase 1 was a potential target molecule for the inhibitory effect of diallyl disulfide on colon cancer cell migration and invasion. PMID: 28358024
  2. Once activated, c-Abl kinase regulated the activity of Vav1, which further affected Rac1/PAK1/LIMK1/cofilin signaling pathway. PMID: 29058761
  3. findings suggest that miR-519d-3p regulates the LIMK1/CFL1 pathway in breast cancer PMID: 29188531
  4. The present study demonstrates that miR-145 plays an important role in inhibiting cell migration by directly targeting PAK4, and identifies miR-145-PAK4-LIMK1-cofilin as a novel regulatory pathway that contributed to colorectal cancer metastasis. PMID: 28440035
  5. In turn, LIMK1 and LIMK2 are required for MT1-MMP-dependent matrix degradation and cell invasion in a three-dimensional type I collagen environment. PMID: 27116935
  6. increased BMPR2 signal transduction is linked to fragile X syndrome (FXS) and that the BMPR2-LIMK1 pathway is a putative therapeutic target in patients with FXS and possibly other forms of autism PMID: 27273096
  7. Report structural basis for noncanonical substrate recognition of cofilin-1/LIMK1 to regulation actin cytoskeleton dynamics. PMID: 27153537
  8. LIMK1 expression is negatively regulated in granular layers-negative psoriatic epidermis or IL-22/IL-24-treated hyperproliferative reconstituted epidermis. These findings suggest a novel regulatory mechanism and a potent role of LIMK1 in psoriatic epidermis. PMID: 27178114
  9. Therefore, miR-138/LIMK1/cofilin may be considered a potential therapeutic target for the treatment of non-small cell lung cancer PMID: 27665963
  10. This study showed that LIMK1 messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples. PMID: 25981171
  11. Gene knockdown/rescue experiments reveal that LIMK1 palmitoylation is essential for normal spine actin polymerization, for spine-specific structural plasticity and for long-term spine stability. PMID: 25884247
  12. LIMK1 is overexpressed in endometrial stromal cells. PMID: 25529997
  13. Data show that the downregulation of miR-138 induced the upregulation of Limk1 in ovarian cancer (OC) cells suggesting that these 2 genes may play a key role in the migration and invasion of OC cells. PMID: 25190487
  14. LIMK1 is overexpressed in gastric cancer. PMID: 25661344
  15. Results show that in addition to a potential role in promoting metastasis, changes in LIMK1 and LIMK2 expression and/or activity might contribute to AR function in prostate cancer via regulation of microtubule cytoskeletal dynamics. PMID: 25344584
  16. CXCL12/CXCR4 signaling has a role in docetaxel-induced microtubule stabilization via p21-activated kinase 4-dependent activation of LIMK1 PMID: 25359780
  17. LIMK1 has a role in regulating human trophoblast invasion/differentiation and is down-regulated in preeclampsia PMID: 25307528
  18. miR-20a is involved in the tumor inhibition of cutaneous squamous cell carcinoma by directly targeting LIMK1 gene. PMID: 25019203
  19. miR-20a plays a role as a tumor suppressor in thyroid cancer cells and targets LIMK1 PMID: 24858712
  20. the functional relevance of the LRAP25-MRCK complex in LIMK1-cofilin signaling and the importance of LRAP adaptors as key determinants of MRCK cellular localization and downstream specificities. PMID: 25107909
  21. Ectopic expression of LIMK1 dramatically dampened mir-27b action of cancer inhibition. PMID: 24390089
  22. ROCK1- and LIMK1-regulated phosphorylation of cofilin played a role in retrovirus release from host cells and in cell-cell transmission events. PMID: 24696479
  23. These results indicate that the overexpression of LIMK1 is tightly associated with an aggressive phenotype of lung cancer cells, knockdown of LIMK1 suppressed cell migration and invasion, enhanced chemosensitivity, suggesting a potential therapeutic target for lung cancer. PMID: 24063279
  24. The authors believe that the Williams-Beuren syndrome chromosome region can be a possible target for further investigation as the genetic basis of keratoconus. PMID: 23167938
  25. DAPK functions as a scaffold for the LIMK/cofilin complex and triggers a closer interaction of both proteins under TNF stimulation. PMID: 23702034
  26. Thus this study provides evidence for a novel role of LIMK1 and SSH-1L in selectively regulating endothelial cell inflammation associated with intravascular coagulation. PMID: 24039253
  27. the conserved region in the LIMK1 3' UTR is involved in regulating LIMK1 expression at the post-transcriptional level PMID: 23700283
  28. LIMK1 plays a novel role in selectively mediating GPIb-IX-dependent TXA2 synthesis and thrombosis. PMID: 23620575
  29. Overexpression of LIMK1 is associated with breast cancer growth and invasiveness. PMID: 23239465
  30. Overexpression of LIMK1 is associated with the development and progression of glioblastoma multiforme. PMID: 23338717
  31. A novel activity of Rho in promoting a complex between fascin-1 and LIMK1/2 that modulates the interaction of fascin-1 with actin, was identified. PMID: 22883572
  32. BDNF-induced TrkB dimerization led to LIMK1 dimerization and transphosphorylation independent of TrkB kinase activity, which could further enhance the activation and stabilization of LIMK1 PMID: 23086941
  33. LIMK1 is associated with the development of ovarian cancer and with the level of tumour differentiation in patients with ovarian carcinoma. PMID: 22906279
  34. Aur-A physically associates with LIMK1 and activates it through phosphorylation, which is important for its centrosomal and spindle pole localization. PMID: 22214762
  35. demonstrated that LIMK1, a key regulator of actin cytoskeleton, was overexpressed at both mRNA and protein levels in MG63/VCR cells and the higher LIMK1 protein level was correlated with higher level of phosphorylated cofilin PMID: 22715593
  36. Data describe the role of LIMK1-mediated CFL1 pathway and actin dynamics in retinoid receptor mediated function and show that LIMK1-mediated phosphocycling of CFL1 plays a role in maintaining actin homeostasis and receptor activity. PMID: 21923909
  37. LIMK1 has a dual role in regulating lamellipodium extension by decelerating actin retrograde flow and polymerization. PMID: 21868383
  38. LIMK1 activity in both the cytoplasmic and nuclear compartments promotes breast cancer progression. PMID: 21682918
  39. LIM kinase 1 modulates cortical actin and CXCR4 cycling and is activated by HIV-1 to initiate viral infection. PMID: 21321123
  40. evealed a SNP, rs6460071 located on LIMK1 gene (P = 0.00069) to be significantly associated with increased risk of intracranial aneurysm PMID: 21228795
  41. LIM kinase1 modulates function of membrane type matrix metalloproteinase 1 in prostate cancer cells PMID: 21219645
  42. Changes in the expression of cytoskeletal regulatory proteins such as LIMK and cofilin may play a role in weakening thoracic aortic medial tissue, as a precondition to thoracic aortic dissection. PMID: 20873970
  43. High LIMK1 is associated with cervical cancer dysplasia. PMID: 20622363
  44. FXa induced myosin light chain phosphorylation and LIMK1 activation resulting in cofilin inactivation PMID: 20347121
  45. phosphorylation of annexin 1 regulates the angiogenic effect that is associated with the activation of the p38/LIM kinase 1 axis by VEGF PMID: 20061392
  46. LIMK1 mediates both the mesenchymal and amoeboid modes of invasion of HT1080 cells. PMID: 20100465
  47. Both LIMK1 and LIMK2 single knock down led to a reduction of invasion and metastatic behavior in the zebrafish xenograft metastasis assay. PMID: 20047470
  48. DGCR6L, a novel PAK4 interacting protein, regulated PAK4-mediated migration of human gastric cancer cells via LIMK1. PMID: 19778628
  49. findings indicate that spatial deficits associated with Williams Syndrome also affect large-scale spatial processing and suggest that hemizygous deletion of LIMK1 is not sufficient to account for any of the spatial deficits associated with this syndrome. PMID: 19662944
  50. Mitosis-specific activation of LIM motif-containing protein kinase and roles of cofilin phosphorylation and dephosphorylation in mitosis. PMID: 11925442

Show More

Hide All

Involvement in disease
LIMK1 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton. Cell projection, lamellipodium.
Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family
Tissue Specificity
Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle.
Database Links

HGNC: 6613

OMIM: 601329

KEGG: hsa:3984

STRING: 9606.ENSP00000336740

UniGene: Hs.647035

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*