Recombinant Human Lipocalin-1 (LCN1)

In Stock
Code CSB-EP012810HU
Abbreviation Recombinant Human LCN1 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
LCN1
Uniprot No.
Research Area
Cell Biology
Alternative Names
Tear lipocalin;Tlc;Tear prealbumin;TP;von Ebner gland protein;VEG protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-176aa
Target Protein Sequence
HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.4
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Could play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. Exhibits an extremely wide ligand pocket.
Gene References into Functions
  1. At the relatively small concentrations in tears, all ceramides were complexed to tear lipocalin. PMID: 29331331
  2. Human neutrophil lipocalin (HNL) concentrations in serum or whole blood activated by formyl-methionine-leucine-phenylalanine (fMLP) were shown to distinguish acute infections of bacterial or viral cause with high accuracy. PMID: 26135974
  3. the possible relationship between ocular symptomatology, tear volume and tear break-up time (TBUT) and lipocalin, lactoferrin and lysozyme concentrations in the tear film were explored in a group of symptomatic dry-eyed postmenopausal (PM) women. PMID: 26366224
  4. Tear lysozyme, lactoferrin and lipocalin concentrations were determined via electrophoresis and the results for patients with or without eyelid tumors were compared. PMID: 25914748
  5. the crosstalk of dendritic cells with lipocalins alone has the potential to direct the type of immune response to these particular antigens. PMID: 26218644
  6. Serum concentrations of LCN1 and LCN2 were both elevated in patients with COPD. PMID: 24920892
  7. Tear lipocalin (TLC) is a major protein in tears and has a large ligand-binding cavity that allows the lipocalin to bind an extensive and diverse set of lipophilic molecules. PMID: 21791187
  8. Study has identified the first protein, lipocalin-1, in the secretome of human blastocysts that is associated with chromosome aneuploidy. PMID: 21324447
  9. The conserved disulfide bond of human tear lipocalin modulates conformation and lipid binding in a ligand selective manner.( PMID: 21466861
  10. Tear lipocalin with the bound artificial ligand 1,4-butanediol has been crystallized in space group P2(1) with four protein molecules in the asymmetric unit and its X-ray structure has been solved at 2.6 A resolution. PMID: 19770509
  11. The N-terminal part of recombinant human tear lipocalin/von Ebner's gland protein confers cysteine proteinase inhibition depending on the presence of the entire cystatin-like sequence motifs. PMID: 11727836
  12. Lcn-1 is specifically produced by corticotrophs PMID: 11850445
  13. LIMR mediating internalization of lipocalin-1 (Lcn-1) in NT2 cells, leading to its degradation. PMID: 12591932
  14. structure, function, and mechanism of action [review] PMID: 12613960
  15. Tear lipocalin is probable protein carrier for vitamin E tears and is candidate to specifically deliver vitamin E as antioxidant to corneal epithelium. PMID: 12613961
  16. Tear surface tension depends partly on presence of tear lipocalin/lipid complex. Tear proteins and lipid-free tear lipocalin lower surface tension. PMID: 12613963
  17. pH-driven ligand release involves ionization changes in several titratable residues associated with CD and EF loop apposition and occlusion of the calyx PMID: 15461462
  18. structural analysis sheds new light on the ligand binding activity of this functionally obscure but abundant human lipocalin PMID: 15489503
  19. Lipocalin is a novel autoantigen target in Sjogren's syndrome. PMID: 16249071
  20. Hydrodynamic and solution properties of lipocalin from human tears show that the protein size and topology are the major determinants of rotational correlation time and a reason for deviation from the Stokes-Einstein relationship. PMID: 17869594
  21. Selective displacement of ANS molecules from the ANS-apoTL complex by stearic acid discriminates the internal and external binding sites. PMID: 17945179
  22. Tear lipocalin is the principal endonuclease in human tear fluid. PMID: 18334931
  23. Results suggest that the excited protein states in tear lipocalin are not unique but consist of many substates. PMID: 19586017

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Tissue Specificity
Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
Database Links

HGNC: 6525

OMIM: 151675

KEGG: hsa:3933

STRING: 9606.ENSP00000263598

UniGene: Hs.530311

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*