Recombinant Human Lutropin subunit beta (LHB)

Code CSB-YP012910HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP012910HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP012910HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP012910HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP012910HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
LHB
Uniprot No.
Alternative Names
Lutropin subunit beta; Lutropin beta chain; Luteinizing hormone subunit beta; LH-B; LSH-B; LSH-beta; LHB
Species
Homo sapiens (Human)
Expression Region
21-141
Target Protein Sequence
SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.
Gene References into Functions
  1. The rs34349826 and rs6521 loci of the LHB gene were not related to male infertility, which can be further confirmed by larger-sample studies. The GG genotype combination is a protective factor against male infertility. PMID: 30173455
  2. Homozygous nonsense mutation Trp28X in the LHB gene causes LH deficiency. PMID: 29476300
  3. A 20-year-old male from a consanguineous family had pubertal delay, hypogonadism and undetectable LH. A homozygous c.118_120del (p.Lys40del) mutation was identified in the patient and his brother, who subsequently had the same phenotype. PMID: 27656125
  4. In girls with central precocious puberty, increased body mass index (BMI) was associated with slightly lower peak stimulated luteinizing hormone (LH) levels at early pubertal stages (Tanner stages 2 and 3). PMID: 27215137
  5. LHbeta G1052A and LHCGR G935A genes polymorphisms are associated with increased risk of polycystic ovary syndrome in Egyptian women especially in obese cases. PMID: 26662070
  6. The Trp8Arg/Ile15Thr polymorphism within the LHB gene was not associated with endometriosis and infertility. PMID: 25935136
  7. This paper shows a conclusive contribution of Variant-Luteinizing hormone to the natural variance in male serum Luteinizing hormone levels PMID: 25820123
  8. the frequency of v-betaLH in Denmark is similar to a number of European countries PMID: 23725475
  9. LH, progesterone, and TSH can stimulate aldosterone. PMID: 24297486
  10. Data indicate a modulatory effect of luteinizing hormone beta-subunit (LHB) gene polymorphisms on hyperandrogenemia phenotype of Polycystic Ovary Syndrome (PCOS) was observed. PMID: 25111116
  11. No association was found between poor ovarian response to ovarian stimulation and variant-betaLH. PMID: 24625195
  12. Both estradiol and progesterone uniquely modulate basal and GnRH-stimulated gonadotropin promoters without affecting cell growth. PMID: 23160221
  13. FOXO1 transcription factor inhibits luteinizing hormone beta gene expression in pituitary gonadotrope cells PMID: 22865884
  14. Results suggested LH G1052A mutation might influence polycystic ovary syndrome susceptibility and phenotypes. PMID: 22546001
  15. Polymorphisms of Trp8Arg and Ile15Thr in the LH-beta subunit gene occur in infertile women. PMID: 22108961
  16. We identified seven SNPs in the LH beta gene; one SNP in exon 3 (rs#1056917) exhibited significant difference in the allele frequency between the PCOS cases and controls PMID: 22209983
  17. the presence of LHbeta G1502A and ERbeta G+1730A polymorphisms is associated with infertility and endometriosis associated infertility.When two polymorphisms are present it does not appear to increase the chance of developing endometriosis or infertility. PMID: 21764500
  18. Both normal-weight and overweight women with classic PCOS phenotypes present higher LH levels and LH-to-FSH ratios than women with similar BMI but the newer phenotypes. PMID: 21353371
  19. A dileucine determinant in the carboxyl terminal sequence of the luteinizing hormone beta subunit is implicated in the regulated secretion of lutropin PMID: 21458524
  20. Variant LH remains longer in circulation than wild type during GnRH receptor blockade in heterozygous women, in accord with its higher content of sialic acid. PMID: 19890021
  21. relationship between endometriosis and a variant of the beta-subunit of luteinizing hormone PMID: 12042273
  22. findings demonstrate that Gly(102)Ser mutation of the LHbeta gene does not affect receptor binding and bioactivity of the hormone, when tested in vitro PMID: 12356936
  23. Results suggest that a single nucleotide polymorphism alters the post-translational modification of luteinizing hormone beta and hence its structural phenotype. PMID: 12683946
  24. MIP-2A (MBP-1 interacting protein-2A) preferentially expresses in certain tissues, including the pituitary gland, and negatively regulates the LHbeta gene transcription PMID: 12700240
  25. genetically determined variation in LH function might affect susceptibility to prostate cancer via altered testosterone secretion. PMID: 12746844
  26. pituitary exit of LH and FSH occur via different secretion pathways, and are released spatially from the pituitary via different circulatory routes. PMID: 14585810
  27. LH modulates the processing of amyloid-beta precursor protein and amyloid-beta deposition PMID: 14871891
  28. LHbeta-null mice are viable but demonstrate postnatal defects in gonadal growth and function resulting in infertility. PMID: 15569941
  29. The tight linkage between the two missense substitutions in the coding region and the eight nucleotide substitutions in the promoter region of LHB appears to be common to various ethnic groups. PMID: 16410673
  30. homozygous mutation of a 5' splice site in LHB: IVS2+1G-->C disrupts the splicing of messenger RNA, generating a gross abnormality in the processing of the luteinizing hormone beta-subunit mRNA, which abrogates the secretion of luteinizing hormone PMID: 17761593
  31. GnRH stimulation of signaling pathway for annexin A5 mRNA expression is distinct from that of LHbeta mRNA and dependent more on MAPK. PMID: 18703851
  32. Progesterone feedback at the level of the pituitary gonadotrope is likely to play a key role in differential production of the gonadotropin genes. PMID: 19106225
  33. Inactivating mutations of luteinizing hormone beta-subunit or luteinizing hormone receptor cause oligo-amenorrhea and infertility in women. PMID: 19129711
  34. v-betaLH is more frequent in women with ovarian resistance to rhFSH. PMID: 19146763

Show More

Hide All

Involvement in disease
Hypogonadotropic hypogonadism 23 without anosmia (HH23)
Subcellular Location
Secreted.
Protein Families
Glycoprotein hormones subunit beta family
Tissue Specificity
Pituitary gland.
Database Links

HGNC: 6584

OMIM: 152780

KEGG: hsa:3972

STRING: 9606.ENSP00000221421

UniGene: Hs.154704

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×