Recombinant Human Lysine-specific demethylase 6A (KDM6A), partial

Code CSB-YP025774HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025774HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP025774HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP025774HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX); bA386N14.2; bA386N14.2 ubiquitously transcribed X chromosome tetratricopeptide repeat protein UTX; DKFZp686A03225; Histone demethylase UTX; KABUK2; Kdm6a; KDM6A_HUMAN; Lysine (K) specific demethylase 6A; Lysine K specific demethylase 6A; Lysine specific demethylase 6A ubiquitously transcribed tetratricopeptide repeat gene X chromosome; Lysine-specific demethylase 6A; MGC141941; Ubiquitously transcribed tetratricopeptide repeat X chromosome; Ubiquitously transcribed tetratricopeptide repeat protein X linked; Ubiquitously transcribed TPR gene on the X chromosome; Ubiquitously transcribed TPR protein on the X chromosome; Ubiquitously transcribed X chromosome tetratricopeptide repeat protein; Ubiquitously-transcribed TPR protein on the X chromosome; Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein; UTX
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Please provide the following information regarding this protein (all expression systems):
1.Sequence
2.Tag type
3.Tag position
4.Pricing, sizes and formats

***Can this protein be used as a positive control for IP/western blot?

A:
Thanks for your inquiry.
Recombinant Human Lysine-specific demethylase 6A(KDM6A) ,partial
CSB-YP025774HU >> Yeast
CSB-EP025774HU >> E.coli
CSB-BP025774HU >> Baculovirus
CSB-MP025774HU >> Mammalian cell
Expression Region: 1095-1258aa; Partial, provide the JmjC Domain
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW


In theory, this protein can be used as a positive control for IP/western blot. But as we haven't validated, so it's not 100% guaranteed.

Target Background

Function
Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitant with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A. Plays a demethylase-independent role in chromatin remodeling to regulate T-box family member-dependent gene expression.
Gene References into Functions
  1. The histone demethylase UTX/KDM6A is mutated in up to 10% of cases of multiple myeloma, activating genes by removing the H3K27me3 repressive histone mark, counteracting EZH2 activity. PMID: 30166694
  2. Lymphomas with low UTX expression express high levels of Efnb1, and cause significantly poor survival. PMID: 30006524
  3. data suggest that haploinsufficiency for KDM6A due to mosaic X chromosome monosomy may be responsible for hyperinsulinism in Turner syndrome. PMID: 29902804
  4. High UTX expression is independently associated with a better prognosis in patients with esophageal squamous cell carcinoma (ESCC) and downregulation of UTX increases ESCC cell growth and decreases E-cadherin expression. Our results suggest that UTX may be a novel therapeutic target for patients with ESCC. PMID: 29351209
  5. Depletion of KDM6A inhibits the expression of SOX9, Col2a1, ACAN and results in increased H3K27me3 and decreased H3K4me3 levels. PMID: 29171124
  6. Rebalance of Histone h3 lysine 27 methylation 3 levels at specific genes through EZH2 inhibitors may be a therapeutic strategy in multiple myeloma cases harboring UTX mutations. PMID: 29045832
  7. both UTX and UTY function as dose-dependent suppressors of urothelial bladder cancer development PMID: 27533081
  8. Two novel missense mutations: p.G325A in the KDM6A gene responsible for Kabuki syndrome and p.G1877V in the SCN1A gene responsible for generalized epilepsy with febrile seizures plus were identified using the TruSight One sequencing panel. PMID: 28442529
  9. inactivating mutations of KDM6A, which are common in urothelial bladder carcinoma, are potentially targetable by inhibiting EZH2. PMID: 28228601
  10. Study presents a mutation screening of patients with Kabuki syndrome type 1 which identified 208 mutations in KMT2D. Two of the KDM6A mutations were maternally inherited and nine were shown to be de novo. PMID: 27302555
  11. Data show that more mutations in the histone lysine demethylase KDM6A were present in non-invasive tumors from females than males. PMID: 29136510
  12. Here, we discuss the roles of lysine 27 demethylases, JMJD3 and UTX, in cancer and potential therapeutic avenues targeting these enzymes. Despite a high degree of sequence similarity in the catalytic domain between JMJD3 and UTX, numerous studies revealed surprisingly contrasting roles in cellular reprogramming and cancer, particularly leukemia PMID: 27151432
  13. we identified a novel de novo deletion of KDM6A in a Chinese girl with KS. We consider her allergic skin manifestations to be part of the phenotypic spectrum of KS PMID: 27028180
  14. KDM6A and p21CIP1 expression are essential to curb E7 induced replication stress to levels that do not markedly interfere with cell viability PMID: 28968467
  15. Study identified a feed-forward loop between UTX and ER in the regulation of hormonally responsive breast carcinogenesis. PMID: 28534508
  16. Mutation in KDM6A gene is associated with cancer more frequently in males. PMID: 27869828
  17. Pathogenic variants in KMT2D resulting in protein truncation in 43% (6/14; of which 3 are novel) of all cases were detected, while analysis of KDM6A was negative. MLPA analysis was negative in all instances. PMID: 26841933
  18. Kdm6a and Kdm6b were found to be significantly overexpressed in Malignant pleural mesothelioma (MPM) at the mRNA level. However, tests examining if targeting therapeutically Kdm6a/b using a specific small molecule inhibitor was potentially useful for treating MPM, revealed that members of the Kdm6 family may not be suitable candidates for therapy PMID: 28197626
  19. The results define UTX as a bivalency-resolving histone modifier necessary for stem cell differentiation PMID: 26762983
  20. UTX gene expression in renal cell carcinoma and bladder cancer. PMID: 27983522
  21. Mutations of the epigenetic genes KMT2D and KDM6A cause dysregulation of certain developmental genes and account for the multiple congenital anomalies of the syndrome PMID: 26898171
  22. UTX positively regulates E-cadherin expression in colon cancer cells. PMID: 26819089
  23. UTX is a prominent tumour suppressor that functions as a negative regulator of EMT-induced Cancer Stem Cell-like properties by epigenetically repressing epithelial-mesenchymal transition -TFs. PMID: 26303947
  24. Kabuki syndrome may be caused by mutations in one of two histone methyltransferase genes: KMT2D and KDM6A. PMID: 26049589
  25. Our results provide further support for the similar roles of KMT2D and KDM6A in the etiology of KS by using a vertebrate model organism to provide direct evidence of their roles in the development of organs and tissues affected in KS patients. PMID: 25972376
  26. Turner Syndrome subjects, who are predisposed to chronic ear infections, had reduced UTX expression in immune cells and decreased circulating CD4(+) CXCR5(+) T cell frequency. PMID: 26431949
  27. A report of novel KDM6A mutations in patients with Kabuki syndrome. PMID: 24527667
  28. The KDM6A gene is a histone demethylase specific for histone H3 Lysin 27 and regulates gene transcription [35]. In approximately 24% of urothelial carcinoma, KDM6A is altered. PMID: 26138514
  29. This study is the first to identify frequent BAP1 and BRCA pathway alterations in bladder cancer, show TERT promoter alterations are independent of other bladder cancer gene alterations, and show KDM6A loss is a driver of the bladder cancer phenotype. PMID: 25225064
  30. One girl had a novel splice-site mutation in KDM6A. PMID: 24739679
  31. Mutations in KMT2D gene were identified in 10/16 (62%) of the patients, whereas none of the patients had KDM6A mutations. PMID: 25281733
  32. H3K27me3 demethylase UTX is a gender-specific tumor suppressor in T-cell acute lymphoblastic leukemia PMID: 25320243
  33. results demonstrate that UTX is implicated in IL-4 mediated transcriptional activation of the ALOX15 gene PMID: 24465480
  34. Results show that UTX interacts with the retinoic acid receptor alpha (RARalpha) and this interaction is essential for proper differentiation of leukemic U937 cells in response to retinoic acid. PMID: 25071154
  35. Both Ezh2 and Kdm6a were shown to affect expression of master regulatory genes involved in adipogenesis and osteogenesis. PMID: 24123378
  36. High levels of UTX or MLL4 are associated with poor prognosis in patients with breast cancer. PMID: 24491801
  37. The identification of novel KDM6A mutations in patients with Kabuki syndrome. PMID: 23913813
  38. PBRM1, KDM6A, SETD2 and BAP1 were unmethylated in all tumor and normal specimens. PMID: 23644518
  39. KDM6A is overexpressed in breast cancer patients with an unfavorable prognosis (mortality at 1 year, p=8.65E-7). PMID: 23266085
  40. This study demonistrated that KDM6A mutations were most commonly identified in subgroups in medulloblastoma. PMID: 23184418
  41. UTX histone demethylase plays important functional role in epigenetic alteration of HOX clusters during retinoic acid-induced neural differentiation. PMID: 23527641
  42. KDM6A contributes to the activation of WNT3 and DKK1 at different differentiation stages when WNT3 and DKK1 are required for mesendoderm and definitive endoderm differentiation. PMID: 22907667
  43. UTX regulates stem cell migration and hematopoiesis. PMID: 23365460
  44. Microdeletions and microduplications have not been identified in the MLL2 and KDM6A genes of a large cohort of patients with Kabuki syndrome. PMID: 22840376
  45. UXT is a potential interactor of HBV Pol. PMID: 21515470
  46. PAN RNA interacts with demethylases JMJD3 and UTX, and the histone methyltransferase MLL2 PMID: 22589717
  47. identification of Utx as a novel mediator with distinct functions during the re-establishment of pluripotency and germ cell development PMID: 22801502
  48. demonstrate that UTX directly associates with the promoters of the Mll1, Runx1, and Scl genes and modulate their transcription by controlling H3K27me3 marks on respective promoter regions. PMID: 22306297
  49. This study identifies KDM6A mutations as another cause of Kabuki syndrome and highlights the growing role of histone methylases and histone demethylases in multiple-congenital-anomaly and intellectual-disability syndromes. PMID: 22197486
  50. H3K27 demethylation by JMJD3 at a poised enhancer of anti-apoptotic gene BCL2 determines ERalpha ligand dependency PMID: 21841772

Show More

Hide All

Involvement in disease
Kabuki syndrome 2 (KABUK2)
Subcellular Location
Nucleus.
Protein Families
UTX family
Database Links

HGNC: 12637

OMIM: 300128

KEGG: hsa:7403

STRING: 9606.ENSP00000367203

UniGene: Hs.522616

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×