Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

LOXL3

Uniprot No.

P58215

Research Area

Signal Transduction

Alternative Names

Lysyl oxidase-like protein 3

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

401-608aa

Target Protein Sequence

DRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHSWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYPGQTSNQII
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

55.7 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Protein-lysine 6-oxidase that mediates the oxidation of peptidyl lysine residues to allysine in target proteins. Catalyzes the post-translational oxidative deamination of peptidyl lysine residues in precursors of elastin and different types of collagens, a prerequisite in the formation of cross-links between collagens and elastin. Required for somite boundary formation by catalyzing oxidation of fibronectin (FN1), enhancing integrin signaling in myofibers and their adhesion to the myotendinous junction (MTJ). Acts as a regulator of inflammatory response by inhibiting differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): acts by interacting with STAT3 in the nucleus and catalyzing both deacetylation and oxidation of lysine residues on STAT3, leading to disrupt STAT3 dimerization and inhibit STAT3 transcription activity. Oxidation of lysine residues to allysine on STAT3 preferentially takes place on lysine residues that are acetylated. Also able to catalyze deacetylation of lysine residues on STAT3.; Shows protein-lysine 6-oxidase activity toward elastin and different types of collagens, with the highest activity toward collagen type VIII.; Shows protein-lysine 6-oxidase activity toward elastin and different types of collagens, with the highest activity toward collagen type IV.

Gene References into Functions

Missense variant in LOXL3 gene is associated with nonsyndromic cleft palate. PMID: 29802726
By deacetylating and deacetyliminating Stat3 on multiple acetyl-lysine sites in nuclei, Loxl3 regulates Stat3 dimerization and transcriptional activity. CD4+ T cell differentiation in inflammatory responses is regulated by the Loxl3-Stat3 signaling pathway PMID: 28065600
Our results suggest that null mutations in LOXL3 are likely associated with autosomal recessive early-onset high myopia. LOXL3 is a potential candidate gene for high myopia, but this possibility should be confirmed in additional studies. PMID: 26957899
LOXL3 is a novel candidate gene for autosomal recessive Stickler syndrome. PMID: 25663169
The human lysyl oxidase-like 3 gene does not confer increased genotypic risk for adolescent idiopathic scoliosis. PMID: 21740577
Lysyl-oxidase-like 3 interacts and cooperates with Snail to downregulate E-cadherin expression, and control epithelial-mesenchymal transitions and carcinoma progression. PMID: 16096638
LOXL3 encodes two variants, LOXL3 and LOXL3-sv1, both of which function as amine oxidases with distinct tissue and substrate specificities from one another. PMID: 17018530
Breast carcinoma effusions showed significantly higher LOXL2 and lower LOXL3 expression compared to primary carcinomas. PMID: 19015874
Expression of LOXL, LOXL2, LOXL3 and LOXL4 was not statistically associated with tumor location, stage, growth type, or differentiation status in colorectal adenocarcinomas PMID: 19724858

Hide All

Involvement in disease

Defects in LOXL3 are found in a family with an autosomal recessive form of Stickler syndrome, an inherited disorder that associates ocular signs with more or less complete forms of Pierre Robin sequence and sensorineural deafness (PubMed:25663169). Pierre Robin sequence includes an opening in the roof of the mouth (a cleft palate) (PubMed:25663169). The degree of hearing loss varies among affected individuals and may become more severe over time (PubMed:25663169). Syndrome expressivity is variable (PubMed:25663169). Ocular disorders include non-progressive myopia with associated chorioretinal degeneration (PubMed:25663169). Defects in LOXL3 are found in another family with early-onset high myopia (PubMed:26957899). The disease may be caused by mutations affecting the gene represented in this entry (PubMed:25663169, PubMed:26957899).

Subcellular Location

Secreted, extracellular space. Cytoplasm. Nucleus.; [Isoform 1]: Secreted, extracellular space.; [Isoform 2]: Cytoplasm. Secreted, extracellular space.

Protein Families

Lysyl oxidase family

Tissue Specificity

Isoform 1: Predominantly detected in the heart, placenta, lung, and small intestine. Isoform 2: Highly detected in the kidney, pancreas, spleen, and thymus, and is absent in lung. In eye, present in all layers of corneas as well as in the limbus and conju

Database Links

HGNC: 13869

OMIM: 607163

KEGG: hsa:84695

STRING: 9606.ENSP00000264094

UniGene: Hs.469045

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP013042HU1
MSDS	MSDS
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Lysyl oxidase homolog 3 (LOXL3), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage