Recombinant Human Macrophage migration inhibitory factor (MIF)

In Stock
Code CSB-EP013826HUa0
Abbreviation Recombinant Human MIF protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
GIF; GLIF; Glycosylation inhibiting factor; Glycosylation-inhibiting factor; L-dopachrome isomerase; L-dopachrome tautomerase; Macrophage migration inhibitory factor (glycosylation-inhibiting factor); Macrophage migration inhibitory factor; MIF; MIF protein; MIF_HUMAN; MMIF; Phenylpyruvate tautomerase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-115aa
Target Protein Sequence
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This high-quality Recombinant Human MIF protein is specifically designed for immunology research applications. This protein, expressed in E. coli, represents the full length of the mature protein (2-115aa) and includes an N-terminal 6xHis-tag for efficient purification. Our MIF protein boasts a purity greater than 90%, as determined by SDS-PAGE, ensuring consistent and reliable results in your experiments.

Investigate the complex roles of MIF in inflammation, immune responses, and pathological conditions with this exceptional recombinant protein. Available in both liquid and lyophilized powder forms, our Recombinant Human MIF protein is a valuable addition to your research toolbox.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Gene References into Functions
  1. These results highlight the importance of MIF overexpression in pancreatic ductal adenocarcinoma aggressiveness, and indicate that MIF may be a potential therapeutic target for pancreatic cancer PMID: 30226561
  2. MIF serum levels are elevated in erythema nodosum leprosum patients as compared to controls. PMID: 28656911
  3. Overall, the present work showed that MIF is a shear stress-sensitive cytokine and is transcriptionally regulated by KLF2, suggesting that laminar shear stress exerts its athero-protective effect in part by directly inhibiting pro-inflammatory MIF expression. PMID: 29403061
  4. Hypoxia-induced angiogenesis is a complex process that involves distinct but also overlapping functions of HIF-1alpha and HIF- 2alpha in regard to angiogenesis, bioenergetic adaption and the redundant transcriptional induction of MIF. PMID: 28993199
  5. that macrophage migration inhibitory factor directly engages in dengue NS1-induced glycocalyx degradation and that targeting MIF may represent a possible therapeutic approach for preventing dengue-induced vascular leakage PMID: 29702687
  6. In this study, we conclude that the CC ge-notype of the MIF -173GC variant may be a risk factor in the pathogenesis of Behcet's Disease in the Turkish population. However, further studies with larger samples are needed to address the exact role of this variant in BD. PMID: 29669352
  7. Study describes a brain glycation profile and identify MIF, an immune regulator and insulin regulator, as being glycated and oxidised in Alzheimer's Disease (AD) brain homogenates. The glycation completely inhibited the oxidoreductase activity of MIF, and severely attenuated its tautomerase activity. PMID: 28230058
  8. our results reveal that MIF expression is a significant independent prognostic factor for patients with oral squamous cell carcinoma PMID: 30041958
  9. the expression of MMIF, HIF-1alpha, and VEGF in the serum and endometrial tissues may be used to assess the stage of endometriosis and the severity of dysmenorrhea. PMID: 30074218
  10. migration inhibitory factor can aggravate diabetic neuropathy by suppressing glyoxalase-I and intraepidermal nerve fibers on the footpad skin lesions and provoke pain. PMID: 29690804
  11. This study provides better understanding of the mechanisms and disease susceptibility for MIF and CD14 genetic variants and inflammatory miRNAs networks involved in ankylosing spondylitis and polyarthralgia. PMID: 29863307
  12. In this review, we summarize and discuss MIF post-translational modifications and their effects on the biological properties of this protein. We propose that the redox-sensitive residues in MIF will be modified at sites of inflammation and that this will add further depth to the functional diversity of this intriguing cytokine PMID: 29247897
  13. meta-analyses revealed significantly higher circulating MIF levels in patients with rheumatoid arthritis, and found evidence of associations between the MIF-173 C/G and -794CATT5-8 polymorphisms and rheumatoid arthritis susceptibility PMID: 28912189
  14. MIF -794 CATT genotypes 7/8 and allele CATT 8 were highly associated with pulmonary tuberculosis in a southwestern China population. PMID: 29809055
  15. Results found MIF and TNFA mRNA expression increased in psoriatic arthritis (PsA) patients with high activity in relation to patients with moderate activity. These results suggest that both mRNA possibly have a role in the progress of the disease severity. PMID: 28965181
  16. The present study indicated that the MIF-173G/C polymorphism may contribute to the development of pulmonary tuberculosis. Furthermore, significantly higher serum MIF levels were observed in pulmonary tuberculosis patients than in controls, which further indicated that the MIF may play an important role in pulmonary tuberculosis progression, particularly in Asians. PMID: 28331211
  17. MIF and IL-6 play important roles in the inflammation associated with polymyositis. PMID: 29239244
  18. The expression collagen type 3, alpha1 (Col3A1), matrix metalloproteinase (MMP)2/-9 and transforming growth factor (TGF)beta was higher in patients with permanent atrial fibrillation (AF), compared with patients in sinus rhythm (SR), and the expression levels of MIF were also increased in AF. MIF was involved in the structural remodeling that accompanies AF, possibly by promoting the proliferation of cardiac fibroblasts. PMID: 29257298
  19. the findings of the present study demonstrated that MIF is a key component in lung cancer progression through promoting the Warburg effect, and that the novel MIF/NFkappaB/HIF1alpha axis may prove to be useful for the development of new strategies for treating patients with lung cancer PMID: 29207023
  20. These results potentially support an effect of MIF, but not Type I IFN, in heightened systemic lupus erythematosus disease severity in Asian systemic lupus erythematosus. The associations of MIF and Asian ethnicity with PAD are at least partly independent PMID: 27453287
  21. High MIF expression is associated with progressive multiple sclerosis. PMID: 28923927
  22. Increased perioperative MIF-levels are related to an increased risk of adverse outcome in complex aortic surgery and may represent a biomarker for risk stratification in complex aortic surgery. PMID: 29120365
  23. No association showed between SLE and the MIF -173 C allele, the -794CATT7 allele, and the -794CATT7-MIF-173C haplotype with high heterogeneity. PMID: 29096759
  24. Studied correlation of serum macrophage migration inhibitory factor (MIF) and atrial fibrillation (AF) patients and healthy subjects; found higher serum MIF concentrations in AF patients than in healthy subjects. PMID: 28407372
  25. genetic polymorphisms of MIF may increase the risk of posttransplant development of donor specific antibodies in kidney allograft recipients PMID: 28624489
  26. We reviewed the association of the MIF rs755622*C allele with systemic sclerosis, and described a phenotype-specific association of this variant with the susceptibility to develop pulmonary arterial hypertension in patients with diffuse cutaneous systemic sclerosis. PMID: 28668810
  27. Authors report that cysteine 81 within MIF serves as a "switch cysteine" for the conversion of redMIF to oxMIF. Modulating cysteine 81 by thiol reactive agents leads to significant structural rearrangements of the protein, resulting in a decreased beta-sheet content and an increased random coil content, but maintaining the trimeric quaternary structure. PMID: 29412660
  28. These findings predict the binding mode of Hu-MIF-1 and orthologs with CD74. PMID: 28513076
  29. Serum MIF provides information about inflammation, brain injury severity and outcome after aSAH PMID: 28823650
  30. MIF in serum might be a potential biomarker for reflecting inflammation, severity and prognosis of ICH patients PMID: 28729134
  31. In conclusion, MIF rs755622 polymorphism increases breast cancer susceptibility in Chinese population, especially among elder patients. PMID: 27844180
  32. MIF coreceptor CD44 is expressed by rheumatoid synovial fibroblasts in a MIF allele-dependent fashion and undergoes functional regulation and activation by autocrine/paracrine MIF PMID: 27872288
  33. High MIF expression is associated with hepatocellular injury and graft rejection. PMID: 28370484
  34. MIF is involved in the pathogenesis of AF, probably by down-regulating the protein and gene expression of Cx43 via ERK1/2 kinase activation PMID: 28429502
  35. Lower circulating migration inhibitory factor protein is associated with metabolic syndrome and diabetes PMID: 28703031
  36. Increased serum MIF levels are associated with the elevation of pre-diabetic risk. PMID: 29289260
  37. Serum macrophage migratory inflammatory factor levels were higher in HD patients (982.74 pg/mL) than that of PD patients (762.20 pg/mL), CKD patients (755.66 pg/mL), or healthy controls (336.81 pg/mL) (P = 0.009). Levels were also significantly increased in patients with left ventricular hypertrophy, and they correlated with the levels of other inflammatory factors. PMID: 27811451
  38. The assay monitors the increase in absorbance at 320 nm resulting from keto-to-enol tautomerization of 4-hydroxyphenylpyruvate, a reaction catalyzed by MIF. We ran a full-diversity screen evaluating the inhibitory activity of 1.6 million compounds. PMID: 26933127
  39. The rs5844572 polymorphism in MIF is linked to the rate of progression and extent of fibrosis in Biliary Atresia Patients, but not with disease susceptibility. PMID: 28657145
  40. Absolute numbers of MIF and IL-1beta mRNA molecules are both accurate and reliable predictors of antidepressant response. PMID: 27207917
  41. The knockdown of D-DT and MIF, individually and additively, inhibited the proliferation, migration, and invasion in HeLa and SiHa cells and restrained the growth of xenograft tumor. PMID: 28338494
  42. No association between coronary artery disease class and -794 CATT5-8 MIF polymorphisms with soluble MIF levels in CAD subjects. PMID: 28578664
  43. These results have implications for the manner in which D-DT and MIF compete with each other for binding to the CD74 receptor and for the relative potency of DRa1-MOG-35-55 and RTL1000 for competitive inhibition of D-DT and MIF binding and activation through CD74. PMID: 27573366
  44. Plasma MIF was elevated after cardiac stress (relative to before stress) in patients with a positive stress test, compared with those with a negative stress test. Plasma MIF is an early marker for myocardial ischemia. MIF was not altered after exercise in peripheral arterial occlusive disease patients, despite the occurrence of claudication, suggesting that plasma MIF is not a marker for skeletal muscle ischemia. PMID: 27364992
  45. Increased serum MIF concentrations have close relation to inflammation, trauma severity and clinical outcomes, substantializing MIF as a good prognostic biomarker after TBI PMID: 28366792
  46. renal tubular MIF is an endogenous renoprotective factor in progressive kidney diseases PMID: 28801314
  47. involved in the pathogenesis of idiopathic pulmonary fibrosis being mainly expressed in the areas of remodeling and active fibrosis, in bronchiolar and alveolar epithelium, and in the peripheral zone of fibroblastic foci PMID: 27337548
  48. MIF is primarily an indirect promoter of glioblastoma progression. PMID: 27145382
  49. frequent upregulation of MIF is implicated in the development and progression ofesophageal squamous cell carcinoma (ESCC). PMID: 29079416
  50. Data highlight the complexity of the MIF/CD74 signaling pathway in the development of mesothelioma. PMID: 26883190

Show More

Hide All

Involvement in disease
Rheumatoid arthritis systemic juvenile (RASJ)
Subcellular Location
Secreted. Cytoplasm.
Protein Families
MIF family
Database Links

HGNC: 7097

OMIM: 153620

KEGG: hsa:4282

STRING: 9606.ENSP00000215754

UniGene: Hs.407995

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*