Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
GIF; GLIF; Glycosylation inhibiting factor; Glycosylation-inhibiting factor; L-dopachrome isomerase; L-dopachrome tautomerase; Macrophage migration inhibitory factor (glycosylation-inhibiting factor); Macrophage migration inhibitory factor; MIF; MIF protein; MIF_HUMAN; MMIF; Phenylpyruvate tautomerase
Species
Homo sapiens (Human)
Expression Region
2-115aa
Target Protein Sequence
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The plasmid vector incorporates the gene encoding the Human MIF protein (2-115aa), generating recombinant plasmid, which is then introduced into baculovirus cells. Selection of positive baculovirus cells is based on their capacity to withstand a particular antibiotic. Subsequently, the baculovirus cells containing the recombinant plasmid are cultivated under conditions that facilitate the expression of the Human MIF gene. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. Following expression, affinity purification is employed to isolate and purify the recombinant Human MIF protein from the cell lysate. Denaturing SDS-PAGE is used to resolve the resulting recombinant protein, enabling an estimation of its purity, exceeding 85%.