Recombinant Human Maleylacetoacetate isomerase (GSTZ1)

Code CSB-EP009994HU
Abbreviation Recombinant Human GSTZ1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
GSTZ1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
EC 2.5.1.18; EC 5.2.1.2; Glutathione S transferase zeta 1; Glutathione S-transferase zeta 1; Gstz1; GSTZ1-1; MAAI; MAAI_HUMAN; Maleylacetoacetate isomerase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-216aa
Target Protein Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.1kDa
Protein Length
Full Length of BC001453
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.
Gene References into Functions
  1. Some properties of cytosolic and mitochondrial GSTZ1 differed. PMID: 29853471
  2. mild hypersuccinylacetonaemia (MHSA)can be caused by sequence variants in GSTZ1. Such individuals have thus far remained asymptomatic despite receiving no specific treatment. PMID: 27876694
  3. rs7975 GG carriers had an increased risk of below-reference sperm motility PMID: 26970898
  4. We conclude that the lower expression of GSTZ1 in Whites who possess the K carrier haplotype results in lower enzymatic activity and slower metabolism of DCA, compared with those who possess the non-K carrier haplotype PMID: 25738370
  5. Haplotype variations in glutathione transferase zeta 1 influence the kinetics and dynamics of chronic dichloroacetate in children PMID: 25079374
  6. The data indicates no association between GSTZ1 genotypes and risk of gastric cancer. PMID: 24719983
  7. Two SNPs, rs282070 located in intron 1 of the MAP3K7 gene, and rs2111699 located in intron 1 of the GSTZ1 gene, were significantly associated (after adjustment for multiple testing) with longevity in stage 2 PMID: 22576335
  8. The ping-pong catalytic mechanism of Se-hGSTZ1-1 is similar to that of the natural GPX. PMID: 23280616
  9. Elucidation of the role of individual residues in the N-terminal, SSC motif of human GSTZ1. PMID: 23299908
  10. This study was performed on 228 BPD patients and 234 control subjects. Among early-onset patients, the variant alleles of Glu32Lys and G-1002A increased BPD susceptibility. PMID: 22374552
  11. e report for the first time the conversion of human glutathione transferase Zeta (hGSTZ1-1) into seleno-hGSTZ1-1 by means of genetic engineering in eukaryotes. PMID: 22561244
  12. The present results indicate that the haplotype of "-1002A, 32Lys, 42Arg" (containing three variant alleles) of GSTZ1 have protective effect compared to the other haplotypes. PMID: 22729907
  13. Our study did not support any association between susceptibility to exudative AMD (age-related macular degeneration) and polymorphisms of GSTZ1. PMID: 21948024
  14. Data suggest neonatal onset and age-related increase in GSTZ1 protein expression during liver development/growth. GSTZ1 haplotype influences activity with dichloroacetate but not protein expression. PMID: 22028318
  15. polymorphisms of GSTZ1 showed strong linkage disequilibrium among cancer patients and control su PMID: 21823988
  16. Results describe the genotypic frequencies of glutathione S-transferase Z1 polymorphisms among an Iranian population. PMID: 21107728
  17. The results of this study did not support the association between genetic polymorphisms of glutathione S-transferase Z1 (GSTZ1) and susceptibility to schizophrenia. PMID: 21183226
  18. subjects with polymorphisms in GSTZ1 have a higher trihalomethanes induced bladder cancer susceptibility PMID: 20675267
  19. A new allele of GSTZ1 (maleylacetoacetate isomerase), characterized by a Thr82Met substitution and termed GSTZ1d, has been identified by analysis of the expressed sequence tag (EST) database. PMID: 11692075
  20. Single nucleotide polymorphisms may alter GSTZ1 expression, which may alter the pharmacokinetics of DCA, which is used therapeutically for the treatment of lactic acidosis. PMID: 16609361
  21. Kinetic studies revealed that the catalytic mechanism of Se-hGSTZ1-1 belong in a ping-pong mechanism similar to that of the natural glutathione peroxidase. PMID: 18373941
  22. The results are consistent with the hypothesis that reduced dopamine metabolism adversely affects cognition. PMID: 18628685

Show More

Hide All

Involvement in disease
Maleylacetoacetate isomerase deficiency (MAAID)
Subcellular Location
Cytoplasm.
Protein Families
GST superfamily, Zeta family
Tissue Specificity
Mostly expressed in liver followed by kidney, skeletal muscle and brain. Also expressed in melanocytes, synovium, placenta, breast and fetal liver and heart.
Database Links

HGNC: 4643

OMIM: 603758

KEGG: hsa:2954

STRING: 9606.ENSP00000216465

UniGene: Hs.655292

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*