Recombinant Human Mammaglobin-A (SCGB2A2)

Code CSB-EP622649HU
MSDS
Size US$162
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SCGB2A2
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
Mammaglobin 1; Mammaglobin-1; Mammaglobin-A; MGB1; Scgb2a2; Secretoglobin family 2A member 2; SG2A2; SG2A2_HUMAN; UGB2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-93aa
Target Protein Sequence
GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
15.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Results support a role for MGB1 in breast cancer malignancy in exchange for chemosensitivity. PMID: 26207726
  2. good coincidence was observed between primary and metastatic tumor GATA3 expression (kappa value = 0.826 >0.75) as compared with the coincidence of GCDFP15 (kappa value =0.492 <0.75) and mammaglobin (kappa value =0.593 <0.75) PMID: 28038704
  3. Expression of MGB1 was higher in breast cancer than non-malignant tissue and it decreased during breast cancer progression. PMID: 27563000
  4. trefoil factor 1 demonstrated breast specificity but was inferior to mammaglobin and GATA protein binding 3 PMID: 26276775
  5. Mammaglobin-A immunohistochemistry in primary central nervous system neoplasms and intracranial metastatic breast carcinoma. Cimino PJ Jr, Perrin RJ PMID: 23958549
  6. Overexpression of hMAM in breast cancer cells decreased migration and invasion, whereas knockdown of hMAM increased both. PMID: 24328556
  7. Mammaglobin immunohistochemistry is useful as a proxy marker for the ETV6-NTRK3 translocation in the diagnosis of salivary mammary analogue secretory carcinoma. PMID: 23773480
  8. High peripheral blood mammaglobin gene expression is associated with metastasis in breast cancer. PMID: 22897908
  9. Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer. PMID: 22963676
  10. MGB1 was detected in endometrial tissue, with peak expression during the luteal phase, in 31% of endometriotic samples, in 53% of endometrial adenocarcinomas, and in 64% of breast carcinomas. PMID: 22994369
  11. Qualitative detection of plasma hMAM mRNA appears to be associated with unfavorable prognostic factors and lower rates of event-free survival in patients with breast cancer. PMID: 23212340
  12. Data show that HLA-A24-restricted, mammaglobin-A (Mam-A) derived, CD8(+) cytotoxic T lymphocyte (CTL) epitopes that can potentially be employed for Mam-A-based breast cancer vaccine therapy to breast cancer patients with HLA-A24 phenotype. PMID: 22074997
  13. A decrease in MGB1+mRNA levels (baseline-week 8) seemed to be associated with clinical response (P = 0.05). PMID: 21976532
  14. MGA detection by the modified nested RT-PCR is a specific marker for circulating tumor cells in patients with breast carcinoma and a negative prognostic factor for the disease PMID: 21939647
  15. High serum mammaglobin is associated with breast cancer. PMID: 21744998
  16. The current knowledge regarding the use of reverse-transcriptase PCR for detecting human mammaglobin mRNA as a biomarker for circulating tumor cells in breast cancer patients, is reviewed. PMID: 21473729
  17. The expression of hMAG was found to be increased with breast cancer grade. PMID: 21623075
  18. Most basal-like breast carcinomas and unclassified triple-negative carcinomas are negative for mammaglobin and gross cystic disease fluid protein 15. PMID: 21411781
  19. Detection of Mammaglobin as part of a 3-marker RT-PCR for early diagnosis of breast cancer. PMID: 20586026
  20. detection of mammaglobin mRNA is useful to determine the effect of therapy while maspin transcripts may indicate more aggressive disease. PMID: 20092039
  21. Expression of MGB1 transcript is associated with breast cancer PMID: 14696125
  22. MGB1 markers may be useful for identifying micrometastases in sentinel lymph nodes of breast cancer patients. PMID: 15151203
  23. Mammaglobin has a role in progression of breast cancer, as shown by its expression in leukapheresis products PMID: 15447988
  24. MGA protein exists in 2 main forms in breast neoplasms PMID: 15609337
  25. occult blood hMAM mRNA can be detected by RT-PCR and may have a role in progression of breast neoplasms PMID: 16110760
  26. mammaglobin expression is associated with expression of estrogen receptor and progesteron receptor in metastasizing breast cancer [letter] PMID: 16203799
  27. MGB1 transcript in peripheral blood of breast cancer patients was specific but with low sensitivity. MGB1 overexpression by itself or in combination with Ki67 might be considered an index of breast cancer rogression PMID: 16760290
  28. mammaglobin mRNA is expressed in breast cancer tissue PMID: 16761620
  29. Mammaglobin A is a highly specific molecular marker for the detection of circulating tumor cells in operable breast cancer, with important prognostic applications. PMID: 16925986
  30. MGB1 immunohistochemistry can serve as a differential marker of breast cancer metastasis from primary lung cancer. PMID: 17192791
  31. successfully generated MGB-specific CD4 T cell cultures and identified candidate MGB HLA class II epitopes PMID: 17653857
  32. The sensitivity of mammaglobin is equal or superior to that of GCDFP-15 for investigation of breast carcinoma. PMID: 18251583
  33. mammaglobin mRNA in peripheral blood may have a role in progression of breast cancer PMID: 18289390
  34. RT-PCR for hMAM test was more sensitive than cytomorphology of breast cancer derived pleural effusion. PMID: 18303409
  35. The overexpression of mammaglobin observed in certain breast tumors is an epiphenomenon not causally involved in breast carcinogenesis. PMID: 18630503
  36. This study demonstrated that human mammaglobin transcripts are expressed in the CSF of a BC patient with LM carcinomatosis. PMID: 18841443
  37. Breast cancer patients with pre-operative elevated bone marrow levels of Mammaglobin Aand/or trefoil factor 1 mRNA seem to constitute a small group of patients with a very poor prognosis. PMID: 18846421
  38. Both MGB1 and GCDFP-15 are specific markers for metastatic breast carcinomas in cell block fluid specimens (88 vs. 96%). PMID: 19217055
  39. Mammaglobin is a sensitive marker of breast carcinoma, it defines a subgroup of patients with better prognosis and is a useful method to detect breast cancer metastases. PMID: 19690758

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Secretoglobin family, Lipophilin subfamily
Tissue Specificity
Mammary gland specific. Over-expressed in breast cancer.
Database Links

HGNC: 7050

OMIM: 605562

KEGG: hsa:4250

STRING: 9606.ENSP00000227918

UniGene: Hs.46452

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*