Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SCGB2A2

Uniprot No.

Q13296

Research Area

Tags & Cell Markers

Alternative Names

Mammaglobin 1; Mammaglobin-1; Mammaglobin-A; MGB1; Scgb2a2; Secretoglobin family 2A member 2; SG2A2; SG2A2_HUMAN; UGB2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-93aa

Target Protein Sequence

MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

37.5kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-93 constitute the expression domain of recombinant Human SCGB2A2. The theoretical molecular weight of the SCGB2A2 protein is 37.5 kDa. Expression of this SCGB2A2 protein is conducted in e.coli. Fusion of the N-terminal GST tag into the SCGB2A2 encoding gene fragment was conducted, allowing for easier detection and purification of the SCGB2A2 protein in subsequent stages.

Human mammaglobin-A (SCGB2A2) is a protein primarily expressed in mammary glands, particularly in breast tissue. It is implicated in mammary gland development and lactation. In cancer research, Mammaglobin-A is recognized as a sensitive marker for detecting breast cancer metastases. It serves as a prognostic tool, aiding in cancer detection and patient stratification. Furthermore, Mammaglobin-A may have potential applications in targeted therapies for breast cancer. Investigating Mammaglobin-A provides insights into breast biology and therapeutic strategies, offering avenues for advancing breast cancer research and clinical management.

Target Background

Gene References into Functions

Results support a role for MGB1 in breast cancer malignancy in exchange for chemosensitivity. PMID: 26207726
good coincidence was observed between primary and metastatic tumor GATA3 expression (kappa value = 0.826 >0.75) as compared with the coincidence of GCDFP15 (kappa value =0.492 <0.75) and mammaglobin (kappa value =0.593 <0.75) PMID: 28038704
Expression of MGB1 was higher in breast cancer than non-malignant tissue and it decreased during breast cancer progression. PMID: 27563000
trefoil factor 1 demonstrated breast specificity but was inferior to mammaglobin and GATA protein binding 3 PMID: 26276775
Mammaglobin-A immunohistochemistry in primary central nervous system neoplasms and intracranial metastatic breast carcinoma. Cimino PJ Jr, Perrin RJ PMID: 23958549
Overexpression of hMAM in breast cancer cells decreased migration and invasion, whereas knockdown of hMAM increased both. PMID: 24328556
Mammaglobin immunohistochemistry is useful as a proxy marker for the ETV6-NTRK3 translocation in the diagnosis of salivary mammary analogue secretory carcinoma. PMID: 23773480
High peripheral blood mammaglobin gene expression is associated with metastasis in breast cancer. PMID: 22897908
Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer. PMID: 22963676
MGB1 was detected in endometrial tissue, with peak expression during the luteal phase, in 31% of endometriotic samples, in 53% of endometrial adenocarcinomas, and in 64% of breast carcinomas. PMID: 22994369
Qualitative detection of plasma hMAM mRNA appears to be associated with unfavorable prognostic factors and lower rates of event-free survival in patients with breast cancer. PMID: 23212340
Data show that HLA-A24-restricted, mammaglobin-A (Mam-A) derived, CD8(+) cytotoxic T lymphocyte (CTL) epitopes that can potentially be employed for Mam-A-based breast cancer vaccine therapy to breast cancer patients with HLA-A24 phenotype. PMID: 22074997
A decrease in MGB1+mRNA levels (baseline-week 8) seemed to be associated with clinical response (P = 0.05). PMID: 21976532
MGA detection by the modified nested RT-PCR is a specific marker for circulating tumor cells in patients with breast carcinoma and a negative prognostic factor for the disease PMID: 21939647
High serum mammaglobin is associated with breast cancer. PMID: 21744998
The current knowledge regarding the use of reverse-transcriptase PCR for detecting human mammaglobin mRNA as a biomarker for circulating tumor cells in breast cancer patients, is reviewed. PMID: 21473729
The expression of hMAG was found to be increased with breast cancer grade. PMID: 21623075
Most basal-like breast carcinomas and unclassified triple-negative carcinomas are negative for mammaglobin and gross cystic disease fluid protein 15. PMID: 21411781
Detection of Mammaglobin as part of a 3-marker RT-PCR for early diagnosis of breast cancer. PMID: 20586026
detection of mammaglobin mRNA is useful to determine the effect of therapy while maspin transcripts may indicate more aggressive disease. PMID: 20092039
Expression of MGB1 transcript is associated with breast cancer PMID: 14696125
MGB1 markers may be useful for identifying micrometastases in sentinel lymph nodes of breast cancer patients. PMID: 15151203
Mammaglobin has a role in progression of breast cancer, as shown by its expression in leukapheresis products PMID: 15447988
MGA protein exists in 2 main forms in breast neoplasms PMID: 15609337
occult blood hMAM mRNA can be detected by RT-PCR and may have a role in progression of breast neoplasms PMID: 16110760
mammaglobin expression is associated with expression of estrogen receptor and progesteron receptor in metastasizing breast cancer [letter] PMID: 16203799
MGB1 transcript in peripheral blood of breast cancer patients was specific but with low sensitivity. MGB1 overexpression by itself or in combination with Ki67 might be considered an index of breast cancer rogression PMID: 16760290
mammaglobin mRNA is expressed in breast cancer tissue PMID: 16761620
Mammaglobin A is a highly specific molecular marker for the detection of circulating tumor cells in operable breast cancer, with important prognostic applications. PMID: 16925986
MGB1 immunohistochemistry can serve as a differential marker of breast cancer metastasis from primary lung cancer. PMID: 17192791
successfully generated MGB-specific CD4 T cell cultures and identified candidate MGB HLA class II epitopes PMID: 17653857
The sensitivity of mammaglobin is equal or superior to that of GCDFP-15 for investigation of breast carcinoma. PMID: 18251583
mammaglobin mRNA in peripheral blood may have a role in progression of breast cancer PMID: 18289390
RT-PCR for hMAM test was more sensitive than cytomorphology of breast cancer derived pleural effusion. PMID: 18303409
The overexpression of mammaglobin observed in certain breast tumors is an epiphenomenon not causally involved in breast carcinogenesis. PMID: 18630503
This study demonstrated that human mammaglobin transcripts are expressed in the CSF of a BC patient with LM carcinomatosis. PMID: 18841443
Breast cancer patients with pre-operative elevated bone marrow levels of Mammaglobin Aand/or trefoil factor 1 mRNA seem to constitute a small group of patients with a very poor prognosis. PMID: 18846421
Both MGB1 and GCDFP-15 are specific markers for metastatic breast carcinomas in cell block fluid specimens (88 vs. 96%). PMID: 19217055
Mammaglobin is a sensitive marker of breast carcinoma, it defines a subgroup of patients with better prognosis and is a useful method to detect breast cancer metastases. PMID: 19690758

Hide All

Subcellular Location

Secreted.

Protein Families

Secretoglobin family, Lipophilin subfamily

Tissue Specificity

Mammary gland specific. Over-expressed in breast cancer.

Database Links

HGNC: 7050

OMIM: 605562

KEGG: hsa:4250

STRING: 9606.ENSP00000227918

UniGene: Hs.46452

Code	CSB-EP622649HU(A4)
Abbreviation	Recombinant Human SCGB2A2 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Mammaglobin-A (SCGB2A2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage