Recombinant Human Mammaglobin-B (SCGB2A1)

Code CSB-EP020816HU
Abbreviation Recombinant Human SCGB2A1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SCGB2A1
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-95aa
Target Protein Sequence
DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.
Gene References into Functions
  1. The expression of HOXB13, IL17BR, and mammaglobin 1 in sentinel lymph nodes predict the outcome of primary breast cancer patients. PMID: 29729704
  2. novel marker GATA3 stains a significantly higher proportion of both primary and metastatic breast carcinomas than GCDFP15 or mammaglobin with stronger and more diffuse staining, helpful in cases with small tissue samples PMID: 25906123
  3. The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome. PMID: 25425335
  4. Results indicate that the quantitative analysis of h-MAM mRNA is a useful tool for detecting CTCs in breast cancer patients. PMID: 24706379
  5. Results indicated that SCGB2A1 represented a novel, prognostic factor for colorectal cancer, and its expression correlated with chemoresistance, radioresistance and cancer cell stemness. PMID: 24585249
  6. The data indicate that MGB1, MGB2 and LIPB mRNAs are expressed at low levels in human tissues but basal expression is upregulated in ovarian cancer. PMID: 24603286
  7. SCGB2A1 is a top differentially expressed gene in all major histological types of ovarian cancers. PMID: 23807163
  8. MGB has the highest expression in HER2-overexpressing breast cancers and may be a potentially useful marker for this subtype. PMID: 23332923
  9. Data show that plasma mammaglobin mRNA alone or in combination with CA15.3 (CD227) may be used as a valuable noninvasive approach for the diagnosis and the detection of metastasis in breast cancer at the time of diagnosis. PMID: 20306663
  10. The mammaglobin/lipophilin B complex is a promising diagnostic marker for breast cancer. PMID: 12022875
  11. MGB2 markers may be useful for identifying micrometastases in sentinel lymph nodes of breast cancer patients. PMID: 15151203
  12. SCGB 2A1 represents a new class of androgen target genes that are purely under indirect AR control mediated by DNA-bound Sp factors. PMID: 16020486
  13. Results indicate that mammaglobin, as measured by the ELISA, holds significant promise for breast cancer screening with the realistic potential to impact management of this disease. PMID: 16166429
  14. MGB-2 is highly expressed in endometrioid endometrial cancer [EEC], particularly in well- and moderately differentiated tumors, and may represent a novel molecular marker for EEC PMID: 18021217
  15. Expression levels of mammaglobins A and B in nasal polyps are not different between patients with and without AR PMID: 18416968
  16. MGB-2 expression characterizes less aggressive forms of EOC and is correlated with a favorable outcome PMID: 19635143

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Secretoglobin family, Lipophilin subfamily
Tissue Specificity
Expressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.
Database Links

HGNC: 7051

OMIM: 604398

KEGG: hsa:4246

STRING: 9606.ENSP00000244930

UniGene: Hs.97644

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*