Recombinant Human STEAP1 protein (STEAP1)

In Stock
Code CSB-CF890691HUd7
Abbreviation Recombinant Human STEAP1 protein
MSDS
Size $1040
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
Six-transmembrane epithelial antigen of prostate 1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-339aa
Target Protein Sequence
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human STEAP1 protein is produced using an E.coli-based cell-free expression system and contains a full-length sequence from 1 to 339 amino acids. The protein features a C-terminal 10xHis-tag that helps with purification and detection. Purity exceeds 85% as verified by SDS-PAGE. With its 6 transmembrane domain structure, the protein uses a detergent platform for improved solubility and stability. This protein is intended for research applications only.

STEAP1, or Six Transmembrane Epithelial Antigen of the Prostate 1, appears to be linked to metal ion transport and reduction processes. The protein seems to play an important role in cellular metal homeostasis, particularly in reducing metal ions to their usable forms. Understanding STEAP1's function may be crucial for research focused on cellular metabolism and metal ion transport mechanisms, potentially offering insights into its involvement in various physiological and pathological processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The human STEAP1 is a complex multi-pass transmembrane protein with 6 transmembrane domains that requires proper integration into a lipid bilayer, correct disulfide bond formation, and potentially metal cofactors for its metalloreductase activity. While the in vitro E.coli system can improve solubility for membrane proteins compared to traditional E. coli expression, they still lack the native membrane environment and eukaryotic folding machinery necessary for proper multi-pass transmembrane protein folding. Without experimental validation of folding (e.g., spectroscopic structural analysis) and activity (e.g., reductase assays), the protein cannot be assumed to be correctly folded or bioactive.

1. Membrane Protein Biochemical Characterization Studies

This application is feasible for basic biophysical characterization of the STEAP1 protein (e.g., circular dichroism for secondary structure, dynamic light scattering for aggregation state). However, the data will reflect the properties of the protein in detergent micelles, which may differ significantly from its native membrane-embedded conformation. Avoid extrapolating results to in vivo structure-function relationships without validation.

2. Antibody Development and Validation

This recombinant STEAP1 is suitable as an immunogen for antibody production, as antibodies can recognize linear epitopes even in misfolded proteins. However, antibodies generated may not recognize the native, properly folded, and membrane-embedded STEAP1 in cellular contexts. Validate antibody specificity against full-length STEAP1 expressed in mammalian cells.

3. Protein-Protein Interaction Studies

Use with extreme caution. While the His-tag enables pull-down assays, the potentially misfolded STEAP1 may exhibit non-physiological interactions. Membrane proteins typically require their native lipid environment for correct interaction interfaces. Any identified partners must be validated using full-length STEAP1 in membrane preparations or cellular systems.

4. Membrane Protein Reconstitution Studies

This is the most appropriate application if successful reconstitution is achieved. The protein can be incorporated into proteoliposomes or nanodiscs to study membrane integration. However, if the initial protein is misfolded from cell-free expression, reconstitution will not restore native structure or function. First, validate folding spectroscopically, and after reconstitution, test metalloreductase activity to confirm functionality.

Final Recommendation & Action Plan

Before using this recombinant STEAP1 for any application, prioritize experimental validation of its structural integrity and potential activity. Start with biophysical characterization (circular dichroism to check secondary structure content against predictions, and analytical ultracentrifugation to assess monodispersity). For functional studies, attempt reconstitution into proteoliposomes with appropriate lipids, then test ferric reductase activity with specific substrates. If activity is confirmed, proceed with interaction or structural studies; otherwise, limit use to antibody production with the caveat that antibodies may require extensive validation against native protein. For reliable results with this complex membrane protein, consider alternative expression systems such as mammalian or insect cells that can provide the proper membrane environment for folding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.
Gene References into Functions
  1. High STEAP1 expression is associated with prostate cancer. PMID: 29464393
  2. Data suggest a solid basis for further research into understanding how six-transmembrane epithelial antigen of prostate member 1 (STEAP1) activities may affect cancer progression. PMID: 27792302
  3. These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression PMID: 25453051
  4. Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions. PMID: 24239460
  5. The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients. PMID: 24025158
  6. STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate. PMID: 23060075
  7. A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane. PMID: 22317770
  8. STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1. PMID: 22080479
  9. STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics. PMID: 22317770
  10. EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells. PMID: 22080479
  11. Data suggest that zoledronic acid may affect cancer cells also by targeting the gene expression of STEAP. PMID: 19915386
  12. Peptide STEAP-292.2L (MLAVFLPIV) may have potential as an antitumor peptide vaccine. PMID: 15958640
  13. STEAP mRNA is used here as a marker to evaluate biological samples from individuals suspected of having cancers, and may provide prognostic information useful in defining appropriate therapeutic options. PMID: 18793824
  14. STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol. PMID: 18958632
  15. STEAPs may represent novel markers of mesenchymal stem cells in man as well as mice. PMID: 19196137

Show More

Hide All

Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Protein Families
STEAP family
Tissue Specificity
Ubiquitously expressed. Highly expressed in prostate tumors.
Database Links

HGNC: 11378

OMIM: 604415

KEGG: hsa:26872

STRING: 9606.ENSP00000297205

UniGene: Hs.61635

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*