Recombinant Human STEAP1 protein (STEAP1)-VLPs

In Stock
Code CSB-MP890691HU
Abbreviation Recombinant Human STEAP1 protein-VLPs
MSDS
Size $620
Order now
Image
  • CSB-MP890691HU is detected by Mouse anti-6*His monoclonal antibody.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
The purity information is not available for VLPs proteins.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Six-transmembrane epithelial antigen of prostate 1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-339aa
Target Protein Sequence
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Human STEAP1 protein comes from a mammalian cell system, which appears to help with proper post-translational modifications and protein folding. The sequence runs from amino acids 1 to 339 - essentially the full-length protein - and includes a C-terminal 10xHis-tag that makes purification and detection more straightforward. What's interesting here is the use of a Virus-Like Particle (VLP) platform. The protein contains six transmembrane domains, which likely makes its structure closer to what we'd see in native forms. Worth noting that purity details aren't available for VLP proteins.

STEAP1 belongs to the six-transmembrane epithelial antigen of prostate family and seems to play a role in metal ion transport. The protein may be involved in cellular ion homeostasis and has drawn attention in cancer biology research, especially regarding prostate cancer. Its function in metal reduction and transport suggests it could be important for understanding how cells proliferate and differentiate.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Human STEAP1 is expressed as virus-like particles (VLPs) in a mammalian cell system. This expression system is highly advantageous for producing complex membrane proteins like STEAP1, which contains 6 transmembrane domains. Mammalian cells provide the appropriate cellular machinery for proper folding, post-translational modifications, and membrane integration. The VLP format further supports native-like membrane presentation. While protein activity is unverified, the expression system makes it highly probable that the protein is correctly folded. However, without specific functional validation (e.g., metalloreductase activity for STEAP1), bioactivity cannot be guaranteed.

1. Membrane Protein Immunogenicity Studies

This application is well-supported. The VLP platform presents STEAP1 in its native transmembrane conformation, making it suitable for studying immune responses against membrane protein epitopes. The full-length expression ensures all potential epitopes are present. This is a valid use case even without activity verification, as it relies primarily on structural presentation.

2. VLP-Based Antibody Development and Screening

This application is appropriate. The VLP presentation helps preserve conformational epitopes, which is advantageous for generating antibodies recognizing the native protein structure. However, the note about the His-tag enabling purification and attachment should be qualified - while the tag facilitates initial purification, its utility for attachment in native conditions may be limited if it's only functional under denaturing conditions (a common limitation for membrane protein tags).

3. Membrane Protein-VLP Interaction Studies

This application requires significant qualifications. While the VLP format provides a membrane environment for studying STEAP1, tags are often inaccessible in native conditions. Interaction studies would require careful optimization and validation with alternative methods.

4. Vaccine Antigen Presentation Research

This application is theoretically possible but requires caution. While VLPs are excellent antigen presentation platforms, STEAP1 is a self-protein (human antigen), and its use in vaccine research carries potential risks of autoimmune responses. It should emphasize basic research applications rather than direct vaccine development. The comparison between soluble and VLP-presented forms is valid for mechanistic studies.

Final Recommendation & Action Plan

This STEAP1-VLP preparation appears most suitable for immunogenicity studies and antibody development applications where native conformation is important. For functional studies, initial validation of protein activity should be performed using appropriate assays (e.g., metalloreductase activity tests). For interaction studies, alternative approaches not relying on tag accessibility should be considered. Given the self-antigen nature of STEAP1, any vaccine-related applications should focus on basic research with appropriate ethical considerations. The mammalian expression system and VLP format provide confidence in protein folding quality, making this reagent valuable for structural and immunological applications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.
Gene References into Functions
  1. High STEAP1 expression is associated with prostate cancer. PMID: 29464393
  2. Data suggest a solid basis for further research into understanding how six-transmembrane epithelial antigen of prostate member 1 (STEAP1) activities may affect cancer progression. PMID: 27792302
  3. These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression PMID: 25453051
  4. Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions. PMID: 24239460
  5. The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients. PMID: 24025158
  6. STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate. PMID: 23060075
  7. A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane. PMID: 22317770
  8. STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1. PMID: 22080479
  9. STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics. PMID: 22317770
  10. EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells. PMID: 22080479
  11. Data suggest that zoledronic acid may affect cancer cells also by targeting the gene expression of STEAP. PMID: 19915386
  12. Peptide STEAP-292.2L (MLAVFLPIV) may have potential as an antitumor peptide vaccine. PMID: 15958640
  13. STEAP mRNA is used here as a marker to evaluate biological samples from individuals suspected of having cancers, and may provide prognostic information useful in defining appropriate therapeutic options. PMID: 18793824
  14. STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol. PMID: 18958632
  15. STEAPs may represent novel markers of mesenchymal stem cells in man as well as mice. PMID: 19196137

Show More

Hide All

Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Protein Families
STEAP family
Tissue Specificity
Ubiquitously expressed. Highly expressed in prostate tumors.
Database Links

HGNC: 11378

OMIM: 604415

KEGG: hsa:26872

STRING: 9606.ENSP00000297205

UniGene: Hs.61635

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*