Recombinant Human Metalloreductase STEAP1 (STEAP1), partial

Discontinued
Code CSB-RP133544h
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
STEAP1; PRSS24; STEAP; Metalloreductase STEAP1; Six-transmembrane epithelial antigen of prostate 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3-69aa
Target Protein Sequence
SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.0kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.
Gene References into Functions
  1. High STEAP1 expression is associated with prostate cancer. PMID: 29464393
  2. Data suggest a solid basis for further research into understanding how six-transmembrane epithelial antigen of prostate member 1 (STEAP1) activities may affect cancer progression. PMID: 27792302
  3. These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression PMID: 25453051
  4. Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions. PMID: 24239460
  5. The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients. PMID: 24025158
  6. STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate. PMID: 23060075
  7. A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane. PMID: 22317770
  8. STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1. PMID: 22080479
  9. STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics. PMID: 22317770
  10. EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells. PMID: 22080479
  11. Data suggest that zoledronic acid may affect cancer cells also by targeting the gene expression of STEAP. PMID: 19915386
  12. Peptide STEAP-292.2L (MLAVFLPIV) may have potential as an antitumor peptide vaccine. PMID: 15958640
  13. STEAP mRNA is used here as a marker to evaluate biological samples from individuals suspected of having cancers, and may provide prognostic information useful in defining appropriate therapeutic options. PMID: 18793824
  14. STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol. PMID: 18958632
  15. STEAPs may represent novel markers of mesenchymal stem cells in man as well as mice. PMID: 19196137

Show More

Hide All

Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Protein Families
STEAP family
Tissue Specificity
Ubiquitously expressed. Highly expressed in prostate tumors.
Database Links

HGNC: 11378

OMIM: 604415

KEGG: hsa:26872

STRING: 9606.ENSP00000297205

UniGene: Hs.61635

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*