Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP015112HU |
| Product Type | Recombinant Protein |
| Size | US$2010 |
| Uniprot No. | P04733 |
| Relevance | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Metallothionein-IF ;MT-IF |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC |
| Research Area | Cancer |
| Source | Yeast |
| Gene Names | MT1F |
| Protein Names | Recommended name: Metallothionein-1F Short name= MT-1F Alternative name(s): Metallothionein-IF Short name= MT-IF |
| Expression Region | 1-59aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 7.9kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
| Protein Families | Metallothionein superfamily, Type 1 family |
| Database Links |
HGNC: 7398 OMIM: 156352 KEGG: hsa:4494 STRING: 9606.ENSP00000334872 UniGene: Hs.513626 |
MT1F Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA17409A0Rb | MT1F Antibody | Human | ELISA |
| CSB-PA17409B0Rb | MT1F Antibody, HRP conjugated | Human | ELISA |
| CSB-PA17409C0Rb | MT1F Antibody, FITC conjugated | Human | ELISA |
| CSB-PA17409D0Rb | MT1F Antibody, Biotin conjugated | Human | ELISA |
MT1F Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP015112HU CSB-BP015112HU CSB-MP015112HU |
Recombinant Human Metallothionein-1F(MT1F) | E.coli Baculovirus Mammalian cell |
Recombinant Human Interferon lambda receptor 1(IFNLR1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Coagulation factor V(F5),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Fibroblast growth factor receptor 3(FGFR3),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Homeobox protein MOX-1(MEOX1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Receptor-type tyrosine-protein phosphatase C(PTPRC),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Phenylalanine-4-hydroxylase(PAH)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
