Recombinant Human Metallothionein-1F(MT1F),partial

Code CSB-YP015112HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P04733
Relevance Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Metallothionein-IF ;MT-IF
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC
Research Area Cancer
Source Yeast
Gene Names MT1F
Protein Names Recommended name: Metallothionein-1F Short name= MT-1F Alternative name(s): Metallothionein-IF Short name= MT-IF
Expression Region 1-59aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 7.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Protein Families Metallothionein superfamily, Type 1 family
Database Links

HGNC: 7398

OMIM: 156352

KEGG: hsa:4494

STRING: 9606.ENSP00000334872

UniGene: Hs.513626

Related Products

MT1F Antibodies

MT1F Antibodies for Human

MT1F Proteins

MT1F Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.