Recombinant Human Metallothionein-1F(MT1F),partial

Code	CSB-YP015112HU
Size	US$1298
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Target Data

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	MT1F
Uniprot No.	P04733
Research Area	Cancer
Alternative Names	MT1F; PRO0376; Metallothionein-1F; MT-1F; Metallothionein-IF; MT-IF
Species	Homo sapiens (Human)
Source	Yeast
Expression Region	1-59aa
Target Protein Sequence	MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	7.9kDa
Protein Length	Partial
Tag Info	N-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Data

Function	Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Gene References into Functions	we found that metallothionein expression induced by Cd occurred much later, with the expression seen at least 12h or more after the Nrf2-dependent immediate responses were almost completed. PMID: 24440467 Metallothionein may have a role in the control of apoptosis in pleomorphic adenoma. PMID: 23332881 Aortic protection in diabetes by zinc supplementation is associated with upregulation of both metallothionein and Nrf2 expression. PMID: 23536959 findings show 5 MT isoforms were overexpressed in non-small cell lung cancer and overexpression of MT-1F and MT-2A predicted poor outcome; both isoforms may be involved in progression of this cancer type; upregulated MT-1F expression associated with larger primary tumor size and higher grade of malignanacy PMID: 23064051 MT1F is a putative tumor suppressor gene in colon carcinogenesis that is downregulated mainly by loss of heterozygosity in colon cancer tissue PMID: 22426038 This study identifies for the first time the relevant metallothionein isoforms for colorectal cancer progression. PMID: 21820154 Studies provide the mechanistic properties of metal binding for metallothionein metallation. PMID: 21409206 MT-1 rs8052394 A allele is associated with oral squamous cell carcinoma. PMID: 21128001 In the liver cancer tissue, MT1F shows down-regulated expression that supports the inhibited function of MT1F in cancer growth PMID: 15369632 Knockdown of MT1F gene increased particular matter(2.5)-induced H2O2 release in alveolar macrophages. PMID: 19251948 Show More Hide All
Protein Families	Metallothionein superfamily, Type 1 family
Database Links	HGNC: 7398 OMIM: 156352 KEGG: hsa:4494 STRING: 9606.ENSP00000334872 UniGene: Hs.513626