Recombinant Human Microfibrillar-associated protein 5 (MFAP5)

In Stock
Code CSB-EP623799HU
Abbreviation Recombinant Human MFAP5 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
AAT9; MAGP 2; MAGP-2; MAGP2; MFAP 5; MFAP-5; MFAP5; MFAP5_HUMAN; Microfibril associated glycoprotein 2; Microfibril-associated glycoprotein 2; microfibrillar associated protein 5; Microfibrillar associated protein 5 precursor ; Microfibrillar-associated protein 5; MP25
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-173aa
Target Protein Sequence
IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 22-173 constitute the expression domain of recombinant Human MFAP5. This MFAP5 protein is theoretically predicted to have a molecular weight of 33.3 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis-SUMO tag into the MFAP5 encoding gene fragment was conducted, allowing for easier detection and purification of the MFAP5 protein in subsequent stages.

Human Microfibrillar-Associated Protein 5 (MFAP5) is involved in extracellular matrix (ECM) organization, interacting with elastin and fibrillin to contribute to tissue elasticity and stability. In vascular biology, MFAP5 regulates elastic fiber assembly, impacting arterial compliance. Its role in tissue development and repair makes MFAP5 relevant in regenerative medicine and wound healing research. In cancer biology, MFAP5 is implicated in tumor progression and metastasis, potentially serving as a prognostic marker. Investigating MFAP5 provides insights into ECM dynamics, vascular physiology, and cancer microenvironment, offering potential applications in cardiovascular research, tissue engineering, and cancer therapeutics.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity. Component of the elastin-associated microfibrils.
Gene References into Functions
  1. MFAP5 was up-regulated in breast cancers compared with that in normal breast tissues, and further increased in breast cancer bone metastasis. Functionally, MFAP5 overexpression accelerated breast cancer cell proliferation and migration, while an opposite effect was observed when MFAP5 was knocked down. PMID: 29526753
  2. Study shows that over-expression of MFAP5 and TNNC1 is correlated with cervical lymph node metastasis (CLNM), metastasis relapse-free survival and overall survival. These results propose that MFAP5 and TNNC1 may be potential markers for predicting occult cervical lymphatic metastasis and prognosis of oral tongue carcinoma. PMID: 27713166
  3. Likely pathogenic variants included a TGFB2 variant in one patient and a SMAD3 variant in another. These variants have been reported previously in individuals with similar phenotypes. Variants of uncertain significance of particular interest included novel variants in MYLK and MFAP5, which were identified in a third patient PMID: 26854089
  4. The results answer the question of how MAGP2 controls cell type dependent Notch signaling, but more importantly uncover a new mechanism to understand how extracellular matrices and cellular environments impact Notch signaling. PMID: 26808411
  5. Our results demonstrate that factors involving low-grade inflammation modulate MFAP5 expression and that the modified expression of MFAP5 may further regulate adipose tissue inflammation. PMID: 26054006
  6. FAK/CREB/TNNC1 has a role in mediating the effect of stromal MFAP5 on ovarian cancer metastatic potential PMID: 25277212
  7. Alteration of MAGP-2, a component of microfibrils and elastic fibers, appears as an initiating mechanism of inherited Thoracic aortic aneurysm and dissection (TAAD). PMID: 25434006
  8. EPS led to the discovery of two novel immunomodulatory proteins, MFAP5 and PENK that when administered to mice subjected to endotoxemic shock, reversed the cytokine storm and provided a significant survival benefit PMID: 24496384
  9. Decreased MFAP5 gene expression in the endometrium of patients with implantation failure after in vitro ertilization treatment PMID: 22885067
  10. The MAGP2-based assay provided superior performance for the purpose of cell culture identification compared to assays using standard reference genes. PMID: 20345228
  11. microfibrillar proteins MAGP-1 and MAGP-2 can function outside of their role in elastic fibers to activate a cellular signaling pathway PMID: 16492672
  12. MAGP-2 promotes angiogenic cell spouting in vitro by antagonizing Notch signaling pathways in endothelial cells. PMID: 18417156
  13. Independent evaluation confirmed the association of a prognostic gene microfibril-associated glycoprotein 2 (MAGP2) with poor prognosis in advanced ovarian cancer PMID: 19962670

Show More

Hide All

Involvement in disease
Aortic aneurysm, familial thoracic 9 (AAT9)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
MFAP family
Database Links

HGNC: 29673

OMIM: 601103

KEGG: hsa:8076

STRING: 9606.ENSP00000352455

UniGene: Hs.512842

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*