Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
AAT9; MAGP 2; MAGP-2; MAGP2; MFAP 5; MFAP-5; MFAP5; MFAP5_HUMAN; Microfibril associated glycoprotein 2; Microfibril-associated glycoprotein 2; microfibrillar associated protein 5; Microfibrillar associated protein 5 precursor ; Microfibrillar-associated protein 5; MP25
Species
Homo sapiens (Human)
Expression Region
22-173aa
Target Protein Sequence
IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 22-173 constitute the expression domain of recombinant Human MFAP5. This MFAP5 protein is theoretically predicted to have a molecular weight of 33.3 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis-SUMO tag into the MFAP5 encoding gene fragment was conducted, allowing for easier detection and purification of the MFAP5 protein in subsequent stages.
Human Microfibrillar-Associated Protein 5 (MFAP5) is involved in extracellular matrix (ECM) organization, interacting with elastin and fibrillin to contribute to tissue elasticity and stability. In vascular biology, MFAP5 regulates elastic fiber assembly, impacting arterial compliance. Its role in tissue development and repair makes MFAP5 relevant in regenerative medicine and wound healing research. In cancer biology, MFAP5 is implicated in tumor progression and metastasis, potentially serving as a prognostic marker. Investigating MFAP5 provides insights into ECM dynamics, vascular physiology, and cancer microenvironment, offering potential applications in cardiovascular research, tissue engineering, and cancer therapeutics.
