Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

MFAP5

Uniprot No.

Q13361

Research Area

Cancer

Alternative Names

AAT9; MAGP 2; MAGP-2; MAGP2; MFAP 5; MFAP-5; MFAP5; MFAP5_HUMAN; Microfibril associated glycoprotein 2; Microfibril-associated glycoprotein 2; microfibrillar associated protein 5; Microfibrillar associated protein 5 precursor ; Microfibrillar-associated protein 5; MP25

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

22-173aa

Target Protein Sequence

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

33.3kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 22-173 constitute the expression domain of recombinant Human MFAP5. This MFAP5 protein is theoretically predicted to have a molecular weight of 33.3 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis-SUMO tag into the MFAP5 encoding gene fragment was conducted, allowing for easier detection and purification of the MFAP5 protein in subsequent stages.

Human Microfibrillar-Associated Protein 5 (MFAP5) is involved in extracellular matrix (ECM) organization, interacting with elastin and fibrillin to contribute to tissue elasticity and stability. In vascular biology, MFAP5 regulates elastic fiber assembly, impacting arterial compliance. Its role in tissue development and repair makes MFAP5 relevant in regenerative medicine and wound healing research. In cancer biology, MFAP5 is implicated in tumor progression and metastasis, potentially serving as a prognostic marker. Investigating MFAP5 provides insights into ECM dynamics, vascular physiology, and cancer microenvironment, offering potential applications in cardiovascular research, tissue engineering, and cancer therapeutics.

Target Background

Function

May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity. Component of the elastin-associated microfibrils.

Gene References into Functions

MFAP5 was up-regulated in breast cancers compared with that in normal breast tissues, and further increased in breast cancer bone metastasis. Functionally, MFAP5 overexpression accelerated breast cancer cell proliferation and migration, while an opposite effect was observed when MFAP5 was knocked down. PMID: 29526753
Study shows that over-expression of MFAP5 and TNNC1 is correlated with cervical lymph node metastasis (CLNM), metastasis relapse-free survival and overall survival. These results propose that MFAP5 and TNNC1 may be potential markers for predicting occult cervical lymphatic metastasis and prognosis of oral tongue carcinoma. PMID: 27713166
Likely pathogenic variants included a TGFB2 variant in one patient and a SMAD3 variant in another. These variants have been reported previously in individuals with similar phenotypes. Variants of uncertain significance of particular interest included novel variants in MYLK and MFAP5, which were identified in a third patient PMID: 26854089
The results answer the question of how MAGP2 controls cell type dependent Notch signaling, but more importantly uncover a new mechanism to understand how extracellular matrices and cellular environments impact Notch signaling. PMID: 26808411
Our results demonstrate that factors involving low-grade inflammation modulate MFAP5 expression and that the modified expression of MFAP5 may further regulate adipose tissue inflammation. PMID: 26054006
FAK/CREB/TNNC1 has a role in mediating the effect of stromal MFAP5 on ovarian cancer metastatic potential PMID: 25277212
Alteration of MAGP-2, a component of microfibrils and elastic fibers, appears as an initiating mechanism of inherited Thoracic aortic aneurysm and dissection (TAAD). PMID: 25434006
EPS led to the discovery of two novel immunomodulatory proteins, MFAP5 and PENK that when administered to mice subjected to endotoxemic shock, reversed the cytokine storm and provided a significant survival benefit PMID: 24496384
Decreased MFAP5 gene expression in the endometrium of patients with implantation failure after in vitro ertilization treatment PMID: 22885067
The MAGP2-based assay provided superior performance for the purpose of cell culture identification compared to assays using standard reference genes. PMID: 20345228
microfibrillar proteins MAGP-1 and MAGP-2 can function outside of their role in elastic fibers to activate a cellular signaling pathway PMID: 16492672
MAGP-2 promotes angiogenic cell spouting in vitro by antagonizing Notch signaling pathways in endothelial cells. PMID: 18417156
Independent evaluation confirmed the association of a prognostic gene microfibril-associated glycoprotein 2 (MAGP2) with poor prognosis in advanced ovarian cancer PMID: 19962670

Hide All

Involvement in disease

Aortic aneurysm, familial thoracic 9 (AAT9)

Subcellular Location

Secreted, extracellular space, extracellular matrix.

Protein Families

MFAP family

Database Links

HGNC: 29673

OMIM: 601103

KEGG: hsa:8076

STRING: 9606.ENSP00000352455

UniGene: Hs.512842

Code	CSB-EP623799HU
Abbreviation	Recombinant Human MFAP5 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Microfibrillar-associated protein 5 (MFAP5)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage