Code | CSB-EP014706HU |
Size | US$1726 |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | MOCS2 |
Uniprot No. | O96007 |
Research Area | Signal Transduction |
Alternative Names | MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-188aa |
Target Protein Sequence | MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 47.9kDa |
Protein Length | Full Length |
Tag Info | N-terminal GST-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group. |
Involvement in disease | Molybdenum cofactor deficiency, complementation group B (MOCODB) |
Subcellular Location | Cytoplasm, cytosol |
Protein Families | MoaE family, MOCS2B subfamily |
Tissue Specificity | Highest levels are found in heart and skeletal muscle. Lower levels are present in brain, kidney and pancreas. Very low levels are found in lung and peripheral blood leukocytes. |
Database Links |
HGNC: 7193 OMIM: 252160 KEGG: hsa:4338 STRING: 9606.ENSP00000380157 UniGene: Hs.163645 |
Recombinant Mouse Hyaluronan synthase 2(Has2),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Macrophage mannose receptor 1(MRC1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Aldehyde dehydrogenase family 1 member A3(ALDH1A3)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human DNA primase small subunit(PRIM1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cysteine-rich protein 1(CRIP1)
Express system: E.coli
Species: Homo sapiens (Human)