Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP014706HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | O96007 |
| Relevance | Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | MOCS2 |
| Protein Names | Recommended name: Molybdopterin synthase catalytic subunit EC= 2.8.1.12 Alternative name(s): MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B Short name= MOCS2B Molybd |
| Expression Region | 1-188aa |
| Tag Info | N-terminal GST-tagged |
| Mol. Weight | 47.9kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group. |
| Involvement in disease | Molybdenum cofactor deficiency, complementation group B (MOCODB) |
| Subcellular Location | Cytoplasm, cytosol |
| Protein Families | MoaE family, MOCS2B subfamily |
| Tissue Specificity | Highest levels are found in heart and skeletal muscle. Lower levels are present in brain, kidney and pancreas. Very low levels are found in lung and peripheral blood leukocytes. |
| Database Links |
HGNC: 7193 OMIM: 252160 KEGG: hsa:4338 STRING: 9606.ENSP00000380157 UniGene: Hs.163645 |
MOCS2 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA014706LA01HU | MOCS2 Antibody | Human | ELISA, WB |
| CSB-PA014706ESR1HU | MOCS2 Antibody | Human | ELISA, WB, IHC, IP, IF |
| CSB-PA014706ESR2HU | MOCS2 Antibody | Human | ELISA, WB, IHC, IP, IF |
MOCS2 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA014706LB01HU | MOCS2 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA014706LC01HU | MOCS2 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA014706LD01HU | MOCS2 Antibody, Biotin conjugated | Human | ELISA |
MOCS2 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP014706HU CSB-BP014706HU CSB-MP014706HU |
Recombinant Human Molybdopterin synthase catalytic subunit(MOCS2) | Yeast Baculovirus Mammalian cell |
MOCS2 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL014706HU | Human Molybdopterin synthase catalytic subunit(MOCS2) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 7 pg/mL |
Recombinant Human Estrogen receptor beta(ESR2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Macaca mulatta Growth hormone receptor(GHR),partial
Express system: E.coli
Species: Macaca mulatta (Rhesus macaque)
Recombinant Human Mannan-binding lectin serine protease 1(MASP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human E3 ubiquitin-protein ligase TRIM21(TRIM21)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Transcription factor PU.1(SPI1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Peroxisomal multifunctional enzyme type 2(HSD17B4)
Express system: Yeast
Species: Homo sapiens (Human)
