Recombinant Human Molybdopterin synthase catalytic subunit(MOCS2)

Code CSB-EP014706HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O96007
Relevance Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS
Research Area Signal Transduction
Source E.coli
Gene Names MOCS2
Protein Names Recommended name: Molybdopterin synthase catalytic subunit EC= 2.8.1.12 Alternative name(s): MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B Short name= MOCS2B Molybd
Expression Region 1-188aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.
Involvement in disease Molybdenum cofactor deficiency, complementation group B (MOCODB)
Subcellular Location Cytoplasm, cytosol
Protein Families MoaE family, MOCS2B subfamily
Tissue Specificity Highest levels are found in heart and skeletal muscle. Lower levels are present in brain, kidney and pancreas. Very low levels are found in lung and peripheral blood leukocytes.
Database Links

HGNC: 7193

OMIM: 252160

KEGG: hsa:4338

STRING: 9606.ENSP00000380157

UniGene: Hs.163645

Related Products

MOCS2 Antibodies

MOCS2 Antibodies for Human

MOCS2 Antibodies for Homo sapiens (Human)

MOCS2 Proteins

MOCS2 Proteins for Homo sapiens (Human)

MOCS2 ELISA Kit

MOCS2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.