Recombinant Human N-alpha-acetyltransferase 50(NAA50)

Code CSB-EP880928HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names NAA50
Uniprot No. Q9GZZ1
Research Area Cell Biology
Alternative Names AK3; FLJ13194; hNAT5; hSAN; Mak3 homolog (S. cerevisiae); Mak3 homolog; N-acetyltransferase 13 (GCN5-related); N-acetyltransferase 13; N-acetyltransferase 5; N-acetyltransferase san homolog; N-alpha-acetyltransferase 50; N-alpha-acetyltransferase 50; NatE catalytic subunit; Naa50; NAA50_HUMAN; NAT 5; NAT13; NAT5; NatE catalytic subunit; San
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-169aa
Target Protein Sequence MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 46.4kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine
Gene References into Functions
  1. Because Naa10 is reported to acetylate all amino termini that are devoid of methionine and Naa50 acetylates all other peptides that are followed by methionine PMID: 27484799
  2. co-depletion of NatA, a heterodimeric NAT complex that physically interacts with Naa50, rescues the sister-chromatid cohesion defects and the resulting mitotic arrest caused by Naa50 depletion, indicating that NatA and Naa50 play antagonistic roles in cohesion. PMID: 27422821
  3. The study quantitatively compared the Nt-acetylomes of wild-type yeast S. cerevisiae expressing the endogenous yeast Naa50 (yNaa50), the congenic strain lacking yNaa50, and an otherwise identical strain expressing human Naa50 (hNaa50). PMID: 25886145
  4. Development of the first N-terminal acetyltransferase (NAT) inhibitors, including a specific Naa50 inhibitor. PMID: 23557624
  5. The first description of the human homologue of Nat5p/San, hNAT5, the third component of the human NatA N-alpha-acetyltransferase complex PMID: 16507339
  6. Nat5 displays both protein N alpha- and N epsilon-acetyltransferase activity. PMID: 19744929
  7. Human protein N-terminal acetyltransferase hNaa50p (hNAT5/hSAN) follows ordered sequential catalytic mechanism: combined kinetic and NMR study. PMID: 22311970
  8. Naa50p can accommodate only an alpha-amino substrate and not a side chain lysine substrate that is acetylated by lysine acetyltransferase enzymes such as Gcn5. PMID: 21900231
  9. May be specifically required for the maintenance of centromeric cohesion in mitosis. PMID: 17502424

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus
Protein Families Acetyltransferase family, GNAT subfamily
Database Links

HGNC: 29533

OMIM: 610834

KEGG: hsa:80218

STRING: 9606.ENSP00000240922

UniGene: Hs.372378

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1