Name: Recombinant Human Neurturin protein (NRTN)
Brand: CUSABIO
SKU: CSB-AP002961HU

Product Details

Purity

>96% as determined by SDS-PAGE and HPLC.

Target Names

NRTN

Uniprot No.

Q99748

Alternative Names

Neurturin; Neurturin precursor; NRTN; NRTN_HUMAN; NTN; prepro-neurturin

Species

Homo sapiens (Human)

Source

E.coli

Complete Sequence

ARLGARPCGL RELEVRVSEL GLGYASDETV LFRYCAGACE AAARVYDLGL RRLRQRRRLR RERVRAQPCC RPTAYEDEVS FLDAHSRYHT VHELSARECA CV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

23.4 kDa

Tag Info

N-terminal His-tagged
Tag-Free

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

What is the difference between product code: CSB-EP016095HU and CSB-AP002961HU?

Very nice to receive your inquiry. As to your inquiry, pls check information as follows:
1.Recombinant Human Neurturin(NRTN)
CSB-EP016095HU
Expression Region :96-197aa; Mature full length protein.
Tag information:N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged
Sequence:

ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

2.Recombinant Human Neurturin protein(NRTN)
CSB-AP002961HU
Lead time: 10-15 working days
Expression Region :96-197aa; Mature full length protein.
Tag information:Untagged.
Sequence:

ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

Both of the two items have the same expression region and sequence, but the first one has tag and the second one is untagged protein.
And the first one hasn't been validated the activity, but the we have validated the activity of the second protein.

Target Background

Function

Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells.

Gene References into Functions

biophysical results show that the relative concentration of GFRa2 on cell surfaces can affect the functional affinity of NRTN through avidity effects. PMID: 29414779
In the cochlea, NTN immunostaining was found in the supporting cells of organ of Corti, including Deiters' cells, Hensen cells as well as Claudius' cells. In the spiral ganglia, NTN was seen in both the cell bodies and the nerve fibers of neurons. PMID: 24139947
Neurturin contributes toward an aggressive cancer cell phenotype, neuropathic pain and neuronal plasticity in pancreatic cancer. PMID: 24067900
Human neurturin protected crayfish neurons and glia from photodynamic injury. PMID: 22847529
Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFRalpha2 isoforms. PMID: 21723942
GDNF and NRTN are new neuromodulators that regulate the development of the neuromuscular synapse PMID: 11790765
The gene expression of protein was studied in the developing human tooth. PMID: 12397373
The results obtained suggest the involvement of NTN, PSP, and ART in processes subserving both the organization of this cortical region during development and the functional activity and maintenance of the mature human hippocampal neurons. PMID: 15829225
Addition of neurturin to activated peripheral blood mononuclear leukocytes reduces the amount of detectable tumor necrosis factor protein without altering its transcription. PMID: 16081799
GDNF and NTN differentially regulate the expression of distinct miRNA precursors through the activation of mitogen-activated protein kinase PMID: 16895582
Depending on the brain's expressions of specific GDNF family GFRalpha2 receptor spliced isoforms, neurturin may promote or inhibit neurite outgrowth through the multicomponent receptor complex. PMID: 17522305
GDNF, NTN, GFRalpha-1, GFRalpha-2, and c-Ret proteins are differentially expressed in the different stages of hair follicle cycle. GFRalpha-mediated signaling involves c-Ret and may play a role in human HF biology. PMID: 18222320
No differences were found in the allelic frequencies of the variants or in the haplotype distribution between Hirschsprung's disease patients & controls, nor to any demographic/clinical parameters within the group of patients. PMID: 18970938

Hide All

Involvement in disease

Genetic variations in NRTN may contribute to Hirschsprung disease, in association with mutations of RET gene, and possibly mutations in other loci. Hirschsprung disease is a disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction.

Subcellular Location

Secreted.

Protein Families

TGF-beta family, GDNF subfamily

Database Links

HGNC: 8007

OMIM: 602018

KEGG: hsa:4902

STRING: 9606.ENSP00000302648

UniGene: Hs.234775