Recombinant Human Nidogen-1 (NID1), partial (R1085A,Y1152A,W1168A,R1194A,Y1196A), partial

In Stock
Code CSB-EP015802HU1(M)
Abbreviation Recombinant Human NID1 protein (R1085A,Y1152A,W1168A,R1194A,Y1196A), partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
NID1
Uniprot No.
Research Area
Cell Biology
Alternative Names
NID-1;Entactin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
927-1247aa(R1085A,Y1152A,W1168A,R1194A,Y1196A)
Target Protein Sequence
IHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLEGNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDLGSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYWTDWNADNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQPSRRKALEGLQAPFAVTSYGKNLYFTDAKMNSVVALDLAISKETDAFQPHKQTALAGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.0 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-extracellular matrix interactions.
Gene References into Functions
  1. Results demonstrated that NID1 was a mesenchymal associated gene and its high expression was significantly correlated with shorter overall survival of ovarian cancer patients. The study presents evidence that NID1 promotes the migration, invasion and chemoresistance of ovarian cancer cells via EMT and its molecular mechanism involves the activation of ERK/MAPK signaling. PMID: 28416770
  2. Nidogen 1 (NID1) was confirmed to promote lung metastasis of breast cancer and melanoma. PMID: 28827399
  3. nidogen-1 degraded by CatS can be quantified in serum by the NIC assay. The current data strongly suggest that cathepsin-S degradation of nidogen-1 is strongly associated with NSCLC, which needs validation in larger clinical cohorts. PMID: 28282545
  4. Differential protein expression of collagen IV, laminin alpha2, and nidogen-1 indicated basal lamina remodeling develops in ischemic failing versus nonfailing human hearts. PMID: 26756417
  5. NID1 was confirmed as a target gene of MiR-192/215 in Hirschsprung's disease patients. PMID: 25857602
  6. Increase of NID1 protein expression is associated with endometrial cancer invasion. PMID: 25924802
  7. The cleavage of nidogen-1 and -2 is partially inhibited in human tumor samples. PMID: 23681936
  8. results demonstrate that mutation in either NID1 or LAMC1 disrupts the interaction NID1-LAMC1 complex; findings implicate the extracellular matrix in the pathogenesis of Dandy-Walker spectrum disorders PMID: 23674478
  9. Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners PMID: 22952693
  10. NID1 gene is a biologically plausible locus for nevogenesis and melanoma development PMID: 21478494
  11. found to be ubiquitous component of basement membrane zones underneath developing epithelia of most of the major organ systems; may participate in cell biological functions during human development PMID: 12005023
  12. nidogen-2 is equivalent to nidogen-1 in skin-organotypic coculture, and both can promote the development of a functional basement membrane zone PMID: 17008882
  13. CpG islands of both NID1 and NID2 genes are aberrantly methylated in human cancer samples and cancer cell lines. PMID: 17328794

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane.
Database Links

HGNC: 7821

OMIM: 131390

KEGG: hsa:4811

STRING: 9606.ENSP00000264187

UniGene: Hs.356624

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*