Recombinant Human Terminal nucleotidyltransferase 4B (TENT4B)

In Stock
Code CSB-EP843329HUa2
Abbreviation Recombinant Human TENT4B protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
PAPD5
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
TENT4B; GLD4; PAPD5; TRF4-2; TUT3; Terminal nucleotidyltransferase 4B; Non-canonical poly(A) RNA polymerase PAPD5; EC 2.7.7.19; PAP-associated domain-containing protein 5; Terminal guanylyltransferase; EC 2.7.7.-; Terminal uridylyltransferase 3; TUTase 3; Topoisomerase-related function protein 4-2; TRF4-2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-572aa
Target Protein Sequence
MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPADSASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
79.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are interested in PAPD5 and PAPD7 proteins. About PAPD5,e.coli system and mammalian system have a bid difference in the cycle,we would like to kknow:
1.What are the differences between the proteins of different expression systems?”thus I know if the extra time for the mammalian expressed version is needed.“
2. Have the two systems been tested for activity?
”has the activity been compared between the systems to know if there are post-translational modifications that are important?“

A:
Thanks for your inquiry. 1. Recombinant Human PAP-associated domain-containing protein 5(PAPD5)
CSB-YP843329HU >> Yeast
CSB-EP843329HUa2 >> E.coli
CSB-BP843329HU >> Baculovirus
CSB-MP843329HU >> Mammalian cell
Expression sequence:1-572aa; Full length of the protein
Tag Information:EP is N-terminal 6xHis-SUMO-tagged;Other possible tags for other systems are N-terminal 6xHis-tagged
Sequence:

MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPADSASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR


1)As for PAPD5, the difference in the delivery time between EP and MP is that EP is a protein that has been developed and shipped before. Therefore, the conditions are all known.
In general, the EP protein expression products are lack of modification (such as glycosylation, alkylation, phosphorylation, specific protein hydrolysis processing, etc.), and the formation of disulfide bonds and wrong folding leads to the formation of inclusion bodies easily.
Generally, the protein expressed by MP has effective protein folding, which is secreted and expressed. It has all kinds of post-translational modifications, including complex n-type glycosylation and accurate o-type glycosylation. Expression products in molecular structure, physical and chemical properties and biological functions
It is most closely related to the natural higher biological protein molecules. The protein itself contains some modifications, such as phosphorylation, which generally affect the function of the protein. So MP is closer to the natural form.
2)We have not conducted active detection of this protein, nor have we received any feedback from customers. We express the full length of the protein, purified under mild conditions, and in theory the EP protein we express will also be active.
2. The site was later removed, discontinued, and the full-length protein only attempted to provide CF expression. Product details are as follows:
Recombinant Human DNA polymerase sigma(PAPD7)
CSB-CF733396HU
Expression sequence: 1-542aa ;Full Length of Isoform 2
Tag Information: N-terminal 10xHis-tagged or N-terminal 6xHis-SUMO-tagged
Sequence:

MSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGGISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCIEDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDAESTLGRIIKVTQEVIDYRRWIKEKWGSKAHPSPGMDSRIKIKERIATCNGEQTQNREPESPYGQRLTLSLSSPQLLSSGSSASSVSSLSGSDVDSDTPPCTTPSVYQFSLQAPAPLMAGLPTALPMPSGKPQPTTSRTLIMTTNNQTRFTIPPPTLGVAPVPCRQAGVEGTASLKAVHHMSSPAIPSASPNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR

Supplementary information on PAPD5 activity:
2)https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3162338/ In this paper, the recombinant PAPD5 expressed in mammalian cells and bacteria is active without protein cofactor;
we analyzed the in vitro properties of recombinant PAPD5 expressed in mammalian cells as well as in bacteria. Our results show that PAPD5 catalyzes the polyadenylation of different types of RNA substrates in vitro.
Interestingly, PAPD5 is active without a protein cofactor

Target Background

Function
Terminal nucleotidyltransferase that catalyzes preferentially the transfert of ATP and GTP on RNA 3' poly(A) tail creating a heterogeneous 3' poly(A) tail leading to mRNAs stabilization by protecting mRNAs from active deadenylation. Also functions as a catalytic subunit of a TRAMP-like complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism. Polyadenylation with short oligo(A) tails is required for the degradative activity of the exosome on several of its nuclear RNA substrates. Doesn't need a cofactor for polyadenylation activity (in vitro). Required for cytoplasmic polyadenylation of mRNAs involved in carbohydrate metabolism, including the glucose transporter SLC2A1/GLUT1. Plays a role in replication-dependent histone mRNA degradation, probably through terminal uridylation of mature histone mRNAs. May play a role in sister chromatid cohesion. Mediates 3' adenylation of the microRNA MIR21 followed by its 3'-to-5' trimming by the exoribonuclease PARN leading to degradation. Mediates 3' adenylation of H/ACA box snoRNAs (small nucleolar RNAs) followed by its 3'-to-5' trimming by the exoribonuclease PARN which enhances snoRNA stability and maturation.
Gene References into Functions
  1. TENT4A and TENT4B produce a mixed tail that shields mRNA from rapid deadenylation. PMID: 30026317
  2. A novel post-transcriptional regulatory network involving carbohydrate metabolism and glucose homeostasis mediated by GLD4. PMID: 28383716
  3. We analyzed the interactions of the human TRAMP-like proteins, PAPD5, ZCCHC7, and MTR4, with the nuclear exosome. PAPD5 and ZCCHC7 exhibited mutual interactions in presence of the exosome catalytic subunit RRP6, whereas MTR4 was dispensable for their assembly PMID: 27434818
  4. PAPD5 and PARN mediate degradation of oncogenic miRNA miR-21. PMID: 25049417
  5. PAPD5 catalyzes the polyadenylation of different types of RNA substrates in vitro. PMID: 21788334

Show More

Hide All

Subcellular Location
Nucleus. Nucleus, nucleolus. Cytoplasm. Note=Predominantly expressed in the cytoplasm (PubMed:18172165).
Protein Families
DNA polymerase type-B-like family
Database Links

HGNC: 30758

OMIM: 605540

KEGG: hsa:64282

STRING: 9606.ENSP00000396995

UniGene: Hs.514342

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*