Recombinant Human Nuclear receptor subfamily 1 group I member 2 (NR1I2)

In Stock
Code CSB-EP016048HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. O75469
Relevance Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP016048HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NR1I2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP016048HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NR1I2.
Storage Buffer Tris-based buffer,50% glycerol
Alias Orphan nuclear receptor PAR1 Orphan nuclear receptor PXR Pregnane X receptor Steroid and xenobiotic receptor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
Research Area Signal Transduction
Source E.coli
Gene Names NR1I2
Protein Names Recommended name: Nuclear receptor subfamily 1 group I member 2 Alternative name(s): Orphan nuclear receptor PAR1 Orphan nuclear receptor PXR Pregnane X receptor Steroid and xenobiotic receptor Short name= SXR
Expression Region 1-434aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 69.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
Subcellular Location Nucleus
Protein Families Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity Expressed in liver, colon and small intestine.
Database Links

HGNC: 7968

OMIM: 603065

KEGG: hsa:8856

STRING: 9606.ENSP00000336528

UniGene: Hs.7303

Related Products

NR1I2 Antibodies

NR1I2 Antibodies for Homo sapiens (Human)

NR1I2 Antibodies for Human

NR1I2 Proteins

NR1I2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.