Recombinant Human Nucleoside diphosphate kinase A (NME1)

In Stock
Code CSB-EP015884HU
Abbreviation Recombinant Human NME1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
NME1
Uniprot No.
Research Area
Developmental Biology
Alternative Names
AWD; AWD, drosophila, homolog of; GAAD; Granzyme A activated DNase; Granzyme A-activated DNase; GZMA activated DNase; Metastasis inhibition factor NM23; NB; NBS; NDK A; NDKA; NDKA_HUMAN; NDP kinase A; NDPK-A; NDPKA; NM23; NM23 long variant, included; nm23-H1; NM23-M1; NM23H1B, included; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-NME2 spliced read-through transcript, included; Non-metastatic cells 1, protein (NM23A) expressed in; Nonmetastatic cells 1, protein expressed in; Nonmetastatic protein 23; Nonmetastatic protein 23, homolog 1; Nucleoside diphosphate kinase A; Tumor metastatic process-associated protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-152aa
Target Protein Sequence
ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair.
Gene References into Functions
  1. NME1 enhanced ALDOC transcription, evidenced by increased expression of ALDOC pre-mRNA and activity of an ALDOC promoter-luciferase module. This is the first study to indicate that NME1 induces transcription through its direct binding to the promoter region of a target gene. PMID: 30396920
  2. NME1 rs16949649 associated with increased susceptibility to gynecological cancer and rs2302254 was linked to reduced gastric cancer risk (Meta-Analysis) PMID: 29525404
  3. Immunohistochemical expression of nm23H1 is not an effective tool to distinguish among the cases of BPH, adenocarcinoma of prostate with and without metastasis. Hence nm23H1 gene does not behave like an antimetastatic gene in prostatic lesions. PMID: 29567887
  4. The positive expression rates of KAI1 and nm23 were significantly lower in laryngeal squamous cell carcinoma than normal laryngeal mucosa. PMID: 29187211
  5. coexistence of high MACC1 and low NM23-H1 expression and tumor budding was associated with short overall survival PMID: 29700912
  6. elevated NDKA was associated with severe characteristics of adenomas (>/=3 lesions, size >/= 1 cm or villous component). Setting specificity to 85%, NDKA showed a sensitivity of 30.19% and 29.82% for advanced adenomas and advanced neoplasia, respectively. PMID: 27222072
  7. This study suggested that EGFR was an important predictive factor for the prognosis of the post-operative patients with colorectal carcinoma TNM stage I-II, and nm23 is important for predicting the prognosis of the patients with stage III-IV; it is better that EGFR and nm23 are as predictor of combination. PMID: 27888614
  8. Results demonstrate that nm23 plays a vital role in decidualization in mice and humans and that nm23 gene expression is hormonally regulated. PMID: 27604954
  9. NM23 might be an indicator of good prognosis in patients with breast cancer, although further researches need to be performed to confirm the prognostic value of NM23. [Meta-analysis; review] PMID: 28161101
  10. The data presented suggest an important role for cytoplasmic IRF6 in regulating the availability or localization of the NME1/2 complex and thus the dynamic behavior of epithelia during lip/palate development. PMID: 28767310
  11. High NME1 expression is associated with well tumor differentiation in Digestive System Neoplasms PMID: 27518571
  12. Hepatitis C Virus E1 protein expression and HCV infection induces pro-metastatic effect on cancer cells which is simultaneous to Nm23-H1 transcriptional down-regulation and Nm23-H1 protein degradation. PMID: 28376369
  13. Meta-analysis showed that low expression of nm23-H1 is associated with poorer prognosis in patients with nasopharyngeal carcinoma, suggesting that it is a prognostic factor and potential biomarker for survival in nasopharyngeal carcinoma. PMID: 28614246
  14. Nm23-H1 nuclear localized mainly in the G2/M phase and the nuclear Nm23-H1 promoted A549 cell proliferation in vitro. PMID: 28442010
  15. Differential regulation of NM23-H1 may corroborate/abrogate EMT depending on the nature of stress, tumor microenvironment and cellular context. PMID: 28216015
  16. large-scale and well-designed studies, which use uniform antibody and criterion of NM23 positive expression, are required to further validate the role of the NM23 in predicting gastric cancer progression. PMID: 28401162
  17. Study reveals that NME1L may perform potent biological roles on the cellular behaviors through the extra N-terminal region as well as hexameric conformation. Because the N-terminal region itself has no effect on NF-kappaB signaling, the dimerization of NME1L is likely a pivotal process to confer the IKKbeta binding ability and subsequent regulation of NF-kappaB signaling on the region. PMID: 27094059
  18. A strong association between NME1 heterozygous genotype and breast cancer risk in Kashmiri population PMID: 27509166
  19. Down-regulation of Dyn1 activity enhances extracellular Nme1 in human colon tumor cell lines. PMID: 27449069
  20. nm23-H1 and MMP-2 may be as an indicator for esophageal cancer metastasis and prognosis PMID: 27592483
  21. Results confirmed that NME1L, but not NME1, is likely responsible for regulating breast cancer cell growth by inhibiting IGF1-stimulated ERK phosphorylation through N-terminal 25 amino acid-mediated interaction with KSR1. PMID: 26565392
  22. CRC patients with NM23-positive tumors had a better prognosis, and thus NM23 expression maybe used as a key prognostic indicator for CRC. PMID: 26634527
  23. NM23 expression is reduced in CRC tissues and low NM23 levels tightly correlate with higher Dukes stages, poorer differentiation grade, and positive lymph node metastases. PMID: 26825905
  24. Fibronectin is an important effector of the motility-suppressing function of NME1 in melanoma cells. PMID: 25808322
  25. Nm23 loss could be associated with a more favorable environment for the development and dissemination of breast cancer PMID: 25321081
  26. Dual functions of NME1 in suppression of cell motility and enhancement of genomic stability in melanoma PMID: 25017017
  27. Regulation of the metastasis suppressor Nm23-H1 by tumor viruses PMID: 25199839
  28. nm23-H1 protein may be an important prognostic factor in peripheral T-cell lymphoma, not otherwise specified;the nm23-H1-positive group had significantly shorter overall survival (Review). PMID: 25501107
  29. The case for extracellular Nm23-H1 as a driver of acute myeloid leukemia (AML) progression PMID: 25119778
  30. Interaction between Nm23 and the tumor suppressor VHL PMID: 24915993
  31. Using the described method for detecting histidine and aspartic acid phosphorylations and our prostate cancer progression cell system, the potential function of NM23-H1 in suppressing metastasis with a two-component regulation system is discussed PMID: 25373728
  32. The metastasis suppressor NME1 regulates expression of genes linked to metastasis and patient outcome in melanoma and breast carcinoma. PMID: 25048347
  33. NM23-H1 may participate in head and neck squamous cell carcinoma cell responses to cisplatin and be considered a potential therapeutic target. PMID: 25277180
  34. NM23H1 gene suppresses hyperplasia and metastasis of prostate cancer, thereby improving the survival rate. PMID: 24858271
  35. Overexpression of Nm23H1 did not affect tumorigenesis in nude mice assays, while overexpression of Nm23H2 enhanced tumor growth with elevated expression of the c-Myc proto-oncogene. PMID: 25748386
  36. NDPK-A was not able to bind to model membranes mimicking the inner leaflet of plasma membrane, suggesting that its in vivo membrane association is mediated by a non-lipidic partner or other partners than the studied phospholipids. PMID: 25010650
  37. Data shows that c-Abl and Arg induce NM23-H1 degradation by increasing expression and activation of cathepsin L and B, which directly cleave NM23-H1 in the lysosome. PMID: 24096484
  38. NME1L is a potent antimetastatic protein and may be a useful weapon in the fight against cancers. PMID: 24811176
  39. findings show NDPKs (NM23-H1/H2/H4) interact with and provide GTP to dynamins, allowing these motor proteins to work with high thermodynamic efficiency for membrane remodeling PMID: 24970086
  40. abnormal lower expression of NME1 in endometriotic stromal cells leads to more secretion of IL-8 and VEGF, up-regulates the level of CD62E and CD105, and leads to angiogenesis of vascular endothelial cells, which promotes development of endometriosis. PMID: 24133580
  41. Abnormally low expression of NME1 in endometrial stromal cells (ESCs) may be involved in the pathogenesis of endometriosis by up-regulating growth, adhesion and invasion of ESCs. PMID: 23856325
  42. Positive expression of Nm23 protein was found in ovarian tissue in 77.7 % cases in BRCA1 mutation carriers and in 90.9 % in the control group. PMID: 23553196
  43. NM23 suppressor protein may have a role in gastric carcinoma pathogenes PMID: 23725501
  44. In laryngeal squamous cell carcinoma patients, the disease recurrence rate correlates inversely with nuclear nm23-H1 expression. PMID: 23768014
  45. Data indicate that the activation of MAPK and PI3K pathways resulted in TGF-beta1 signaling by down-regulating Nm23-H1 expression and up-regulating the expression of TbetaRI and TbetaRII, favoring further activation of multiple signaling pathways. PMID: 23734265
  46. High NM23-H1 expression is associated with radioresistance in nasopharyngeal carcinoma. PMID: 23464856
  47. High NM23 expression is associated with sporadic colorectal cancer. PMID: 23679306
  48. Reduced nm23 immunohistochemical expression is an independent negative prognostic factor for overall survival and progression-free survival in invasive breast cancer. PMID: 23818346
  49. The crystal structure of oxidized Nm23-H1 is presented. It reveals the formation of an intramolecular disulfide bond between Cys4 and Cys145 that triggers a large conformational change that destabilizes the hexameric state. PMID: 23519676
  50. NM23 demonstrated no discriminatory value in the interpretation of lymph node nevus rests. PMID: 23694823

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Note=Cell-cycle dependent nuclear localization which can be induced by interaction with Epstein-barr viral proteins or by degradation of the SET complex by GzmA.
Protein Families
NDK family
Tissue Specificity
Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to t
Database Links

HGNC: 7849

OMIM: 156490

KEGG: hsa:4830

STRING: 9606.ENSP00000013034

UniGene: Hs.463456

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*