Recombinant Human Peptidyl-tRNA hydrolase ICT1, mitochondrial (ICT1)

Code CSB-EP613490HU
Abbreviation Recombinant Human ICT1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MRPL58
Uniprot No.
Research Area
Metabolism
Alternative Names
Digestion substraction 1; DS-1; DS1; Ict1; ICT1_HUMAN; Immature colon carcinoma transcript 1; Immature colon carcinoma transcript 1 protein; mitochondrial; Peptidyl-tRNA hydrolase ICT1; Peptidyl-tRNA hydrolase ICT1, mitochondrial
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-206aa
Target Protein Sequence
LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.
Gene References into Functions
  1. High ICT1 expression is associated with leukemia. PMID: 29328466
  2. ICT1 overexpression notably predicted poor prognosis of gastric cancer patients. PMID: 28987942
  3. Study demonstrates that ICT1 overexpression correlates with malignant clinical features and poor prognosis of hepatocellular carcinoma (HCC) patients. Functionally, ICT1 promotes proliferation, cell cycle progression and inhibits apoptosis of HCC cells. ICT1 regulates the expressions of CDK1, cyclin B1, Bcl-2 and Bax, and is directly targeted by microRNA-134 (miR-134) in HCC cells. PMID: 29130100
  4. ICT1 may play a crucial role in promoting gastric cancer proliferation in vitro. PMID: 29036264
  5. The results provide direct evidence that localized feedbacks on Fat4-Ds1 complexes can give rise to planar cell polarity. PMID: 28826487
  6. our preliminary study reveals the important role of ICT1 in NSCLC cells that knockdown of ICT1 significantly suppressed cell proliferation, arrested cell cycle though altering expression cell cycle regulators, and promoted cell apoptosis. PMID: 27413166
  7. ICT1 knockdown significantly inhibited cell proliferation and migration, led to G2/M phase cell-cycle arrest, and triggered apoptosis via the intracellular AMPKa, SAPK/JNK, and PARP signaling pathways. PMID: 27411551
  8. ICT1 was significantly upregulated in diffuse large B-cell lymphoma tissues (DLBCL) and correlated with poor survival. Knockdown of ICT1 remarkably induced cell cycle G0/G phase arrest and apoptosis in DLBCL cells. PMID: 28629825
  9. ICT1 knockdown altered the expression of apoptosis- or cell cyclerelated proteins such as Bcl-2, caspase-3, CDK1, CDK2 and cyclin B. PMID: 28290601
  10. ICT1 may be essential for hydrolysis of prematurely terminated peptidyl-tRNA moieties in stalled mitoribosomes. PMID: 20186120

Show More

Hide All

Subcellular Location
Mitochondrion.
Protein Families
Prokaryotic/mitochondrial release factor family, Mitochondrion-specific ribosomal protein mL62 subfamily
Tissue Specificity
Down-regulated during the in vitro differentiation of HT29-D4 colon carcinoma cells.
Database Links

HGNC: 5359

OMIM: 603000

KEGG: hsa:3396

STRING: 9606.ENSP00000301585

UniGene: Hs.407955

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*