Recombinant Human Phenylethanolamine N-methyltransferase (PNMT)

In Stock
Code CSB-EP018274HU
Abbreviation Recombinant Human PNMT protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
PNMT
Uniprot No.
Research Area
Neuroscience
Alternative Names
Noradrenaline N-methyltransferase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-282aa
Target Protein Sequence
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.8 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Converts noradrenaline to adrenaline.
Gene References into Functions
  1. PNMT underexpression is associated with malignant pheochromocytoma and paraganglioma. PMID: 27007161
  2. initial velocity studies on human PNMT in the absence and presence of product and dead end inhibitors. PMID: 24018397
  3. The 2-SNP AA haplotype in the PNMT promoter is associated with decreased risk of essential hypertension in Han Chinese. PMID: 21866188
  4. PNMT G-390A polymorphism is possibly associated with essential hypertension risk in male Chinese Han population. PMID: 19952402
  5. In Caucasians, phenylethanolamine N-methyltransferase single nucleotide polymorphisms are associated with the development of acute kidney injury, disease severity, and in-hospital mortality. PMID: 20090367
  6. PNMT variants in cis may interact with nuclear factors in trans to govern adrenergic activity. PMID: 20204374
  7. Human PNMT has been crystallized in complex with an inhibitor and the cofactor product S-adenosyl-L-homocysteine and diffraction data measured from a cryocooled crystal extend to a resolution of 2.3 A. PMID: 11807261
  8. pharmacologic and biochemical evidence of beta-carboline 2N-methyltransferase activity PMID: 11900856
  9. Association between the phenylethanolamine N-methyltransferase gene and multiple sclerosis. PMID: 11958827
  10. homozygosity/heterozygosity of the phenylethanolamine N-methyltransferase gene polymorphism was highly predictive of significant weight loss with sibutramine during the first 3 months of obesity treatment PMID: 12634439
  11. genetic variants of PNMT may play a role in the development of essential hypertension. PMID: 14553966
  12. Presence of local PNMT transcription in human heart after transplantation. PMID: 15848714
  13. disulfide-linked dimers are as active as the monomeric enzyme indicating that the crystal structure of the protein is a valid target for inhibitor design. PMID: 15893506
  14. Nicotinic stimuli appear to regulate expression of the epinephrine-synthesizing gene PNMT through a previously uncharacterized regulatory element. PMID: 15968085
  15. Results suggest that PNMT catalyzes transfer of methyl to ligand amines only when "anchor" interactions, such as those identified for the beta-hydroxyls of p-octopamine and cis-AT, are present. PMID: 16363801
  16. the differences in PNMT expression between normotensives and hypertensives are not determined by the polymorphisms in this gene, but rather by the interplay of gene expression regulators, which may vary among individuals PMID: 17645789
  17. We examined the correlation between reward dependence (RD) trait, and 5 polymorphisms in genes of norepinephrine pathways. We found that rs3764351 in PNMT was significantly associated with reward dependence trait. PMID: 18702937
  18. Haplotypes of the phenylethanolamine N-methyltransferase (PNMT), catechol-O-methyltransferase (COMT) have functionally important effects on alcohol-induced cardiovascular symptoms by affecting blood catecholamine levels. PMID: 18715275
  19. The crystal structures illustrate the adaptability of the PNMT substrate binding site in accepting multi-fused ring systems, such as substituted norbornene, as well as noradrenochrome, the oxidation product of noradrenaline. PMID: 19570037
  20. the reaction takes place via an SN2 mechanism with methyl transfer being rate-limiting PMID: 19733262
  21. Oncogenomic recombination hotspot around the PPP1R1B-STARD3-TCAP-PNMT-PERLD1-ERBB2-C17orf37-GRB7 amplicon at human chromosome 17q12 is closely linked to evolutionary recombination hotspot around the GSDML-GSDM locus. PMID: 15010812

Show More

Hide All

Protein Families
Class I-like SAM-binding methyltransferase superfamily, NNMT/PNMT/TEMT family
Database Links

HGNC: 9160

OMIM: 171190

KEGG: hsa:5409

STRING: 9606.ENSP00000269582

UniGene: Hs.1892

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*