Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PLAC1

Uniprot No.

Q9HBJ0

Research Area

Developmental Biology

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

23-212aa

Target Protein Sequence

QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.3 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 23-212 constitute the expression domain of recombinant Human PLAC1. This PLAC1 protein is theoretically predicted to have a molecular weight of 23.3 kDa. This PLAC1 recombinant protein is manufactured in e.coli. The PLAC1 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant PLAC1 protein during the following stages.

Human placenta-specific protein 1 (PLAC1) is a protein primarily associated with placental development and function. PLAC1 is expressed predominantly in the placenta, specifically in trophoblast cells, indicating its role in fetal-maternal interactions. PLAC1 is implicated in key processes such as trophoblast invasion, a critical step for successful implantation and placental development. Aberrant PLAC1 expression has been observed in certain pregnancy-related disorders, suggesting its potential relevance as a biomarker or factor in complications like preeclampsia.

Target Background

Function

May play a role in placental development.

Gene References into Functions

The findings suggest a possible pathophysiological link between the development of Fetal growth restriction and the expression of PAPPA, PAPPA2 and PLAC-1. PMID: 29532882
Screening for these five CTAs and PLAC1 by RTqPCR may offer a potentially valuable prognostic tool with good sensitivity and specificity in patients with Hepatocellular carcinoma (HCC) that may be enhanced by magneticactivated cell sorting . PMID: 28849093
Study revealed that PLAC1 expression was highly expressed in non-small cell lung cancer (NSCLC) tissues, suggesting that PLAC1 may be a prognostic factor and higher risk for NSCLC patients. PLAC1 was involved in regulation of the proliferation, migration, and invasion abilities of NSCLC cells partly through regulation of epithelial-mesenchymal transition and the AKT pathway. PMID: 29138842
There was no significant correlation of serum PLAC1 levels with race, age at diagnosis, body mass index (BMI) or the presence of metastatic disease. It remains to be determined whether PLAC1 serum levels can serve as a diagnostic biomarker for the presence or recurrence of disease post-surgery and/or therapy PMID: 29432428
this paper shows that PLAC1 immunization does not induce infertility in mice PMID: 28351180
Optimized protocol for soluble prokaryotic expression, purification and structural analysis of human placenta specific-1(PLAC1). PMID: 28315746
we show that PLAC1 transcript number is significantly negatively correlated with patient survival in our samples. Thus, we suggest that characterizing tumors for TP53 mutation status, p53 protein status and PLAC1 transcription could be used to predict likely prognosis and inform treatment options in patients diagnosed with serous ovarian cancer. PMID: 28339050
This study demonstrated that the protein expression of PLAC1 was significantly associated with decreased overall survival in patients with pancreatic ductal adenocarcinoma, indicating that it was a valuable prognostic marker for pancreatic ductal adenocarcinoma and might be a potential target for immunotherapy. PMID: 28618924
Plac1 plays a pivotal role in the progression of HCC, and may serve as a novel therapeutic target for Hepatocellular carcinoma. PMID: 27878289
PLAC1 was mainly expressed in the human villous syncytiotrophoblast (STB) layer throughout gestation, and the expression level of PLAC1 was significantly elevated during human trophoblast syncytialization. PMID: 27692364
PLAC1/CP1 provides a marker for identifying gastric cancers with poor prognosis, and suggest that PLAC1/CP1 may provide a useful target for immunotherapy. PMID: 26157147
circulating mRNA improved detection rate of pre-eclampsia PMID: 25138310
Data suggests that PLAC1 plays an important role in human placental trophoblast invasion and migration. PMID: 24989904
This data suggests that the Epstein-Barr virus-induced PLAC1 is a member of the cancer/testis group of tumor antigens. PMID: 24912876
PLAC1/CP1 antigen is a possible prognostic marker of colorectal carcinoma, and PLAC1/CP1 p41-50 and PLAC1/CP1 p69-77 are novel HLA-A*0201-restricted CD8+ T cell epitopes PMID: 23604623
NCOA3 is a selective co-activator of estrogen receptor alpha-mediated transactivation of PLAC1. PMID: 24304549
we identified a novel specific antitrophoblast antibody, anti-PLAC1, in infertile women with repeated unexplained implantation failure. PLAC1 shows placenta-specific expression and is localized primarily in the syncytiotrophoblast. PMID: 23434395
A novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 has been identified in breast cancer. PMID: 21710262
The expression of PLAC1/CP1 genes correlates with various clinical and pathologic parameters in primary colorectal carcinoma. PMID: 21215095
A potential role for PLAC1 as a biomarker predictive of specific pregnancy complications, such as preeclampsia. PMID: 20509147
PLAC1, a trophoblast-specific gene, is Trophoblast-specific expression throughout gestation and responsiveness to KGF are consistent with a fundamental role for PLAC1 at the maternal-fetal interface. PMID: 12412044
mRNA transcripts from placenta-expressed specific gene are detectable in maternal blood and rapidly disappear after delivery PMID: 15608456
PLAC1 expression is upregulated during trophoblast differentiation, localizing primarily to the differentiated syncytiotrophoblast. PMID: 15803460
Plasma PLAC1 and glial cells-missing 1 mRNAs appear promising as noninvasively measurable molecular markers for pre-eclampsia PMID: 16594548
In induced term pregnancies, PLAC1 mRNA in maternal blood at the beginning of the treatment correlates with time elapsed before delivery; this demonstrates that fetomaternal trafficking of nucleic acids is more consistent when labor is about to begin. PMID: 16860456
Data show that PLAC1 is restricted primarily to the differentiated trophoblast, localizing to intracellular membranous compartment(s) in the apical region of the syncytiotrophoblast and associated with its apical, microvillous membrane surface. PMID: 17186554
CRH, PLAC1, and selectin-P are distributed differently in preeclampsia cases compared to controls and correlate with signs of preeclampsia. PMID: 17554801
RNAi-mediated silencing of PLAC1 in MCF-7 and BT-549 breast cancer cells profoundly impairs motility, migration, and invasion and induces a G1-S cell cycle block with nearly complete abrogation of proliferation. PMID: 17909063
study demonstrated that PLAC1 is a novel tumor antigen with very restricted normal tissue expression; also evidence provided that PLAC1 is expressed in the tumor cells in a subset of lung cancer patients PMID: 17983203
3.8% (4/101) of HCC patients had anti-PLAC1 antibody response, suggesting the immunogenicity of PLAC1 in HCC patients. PLAC1 represents a new class of tumor associated antigen with restricted expression in placenta and cancer tissues. PMID: 18183594
analysis of activation of trophoblast-specific PLAC1 in breast cancer by CCAAT/enhancer-binding protein beta (C/EBPbeta) isoform 2 PMID: 19652226
In normal tissues, PLAC1 expression was restricted to the placenta while developmental pluripotency associated-2 expression was restricted to the placenta and testis. PMID: 19705800

Hide All

Subcellular Location

Secreted.

Protein Families

PLAC1 family

Tissue Specificity

Expressed in placenta. Localizes primarily to differentiated syncytiotrophoblast throughout gestation as well as to a small population of villous cytotrophoblasts. Also detected in maternal blood and rapidly disappears following delivery, but is not detec

Database Links

HGNC: 9044

OMIM: 300296

KEGG: hsa:10761

STRING: 9606.ENSP00000352173

UniGene: Hs.496811

Code	CSB-EP867193HU
Abbreviation	Recombinant Human PLAC1 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Placenta-specific protein 1 (PLAC1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage