Recombinant Human Potassium channel subfamily K member 2 (KCNK2), partial

Code CSB-YP012070HU
Abbreviation Recombinant Human KCNK2 protein, partial
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
hTREK 1c; hTREK 1e; K2p2.1; K2P2.1 potassium channel; KCNK 2; Kcnk2; KCNK2_HUMAN; MGC126742; MGC126744; Outward rectifying potassium channel protein TREK 1; Outward rectifying potassium channel protein TREK-1; Outward rectifying potassium channel protein TREK1; Potassium channel subfamily K member 2; Potassium inwardly rectifying channel subfamily K member 2; Tandem pore domain potassium channel TREK 1; Tandem pore domain potassium channel TREK1; TPKC1; TREK 1; TREK 1 K(+) channel subunit; TREK; TREK-1 K(+) channel subunit; TREK1; TWIK related potassium channel 1; Two pore domain potassium channel TREK 1 ; Two pore domain potassium channel TREK-1; Two pore domain potassium channel TREK1; Two pore potassium channel 1; Two pore potassium channel TPKC1
Species
Homo sapiens (Human)
Source
Yeast
Target Protein Sequence
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.7kDa
Protein Length
1-143aa
Tag Info
N-terminal His-tagged
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ion channel that contributes to passive transmembrane potassium transport. Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner. In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2. In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1.; Does not display channel activity but reduces the channel activity of isoform 1 and isoform 2 and reduces cell surface expression of isoform 2.
Gene References into Functions
  1. data reveal a druggable K2P site that stabilizes the C-type gate 'leak mode' and provide direct evidence for K2P selectivity filter gating PMID: 28693035
  2. decreased TREK-1 expression in the aganglionic and ganglionic bowel observed in Hirschsprung's disease may alter intestinal epithelial barrier function leading to the development of enterocolitis PMID: 27384506
  3. Atrial TREK-1 expression was reduced in atrial fibrillation patients with concomitant severe heart failure PMID: 28005193
  4. The authors identified a heterozygous point mutation in the selectivity filter of the stretch-activated K2P potassium channel TREK-1 (KCNK2 or K2P2.1). This mutation introduces abnormal sodium permeability and stretch-activation hypersensitivity to TREK-1. PMID: 28242754
  5. downregulated in overactive detrusor PMID: 28539337
  6. The M2-glycine hinge controls the macroscopic currents of TREK1 channels. PMID: 28676394
  7. TREK-1 overexpression suppresses CHO cell proliferation by inhibiting the activity of PKA and p38/MAPK signaling pathways and subsequently inducing G1 phase cell arrest. PMID: 27397543
  8. Trek1 expression facilitates the restoration of intestinal epithelial barrier functions in an allergic environment. PMID: 25683610
  9. presence of TREK-1 variants correlated to reduced TREK-1 activity, suggesting a pathological role for TREK-1 variants in preterm labor PMID: 26400398
  10. Data suggest that potassium channel protein TREK-1 (TREK-1) might be a biomarker in castration resistance free survival (CRFS) judgment of prostate cancer (PCa), as well as a potential therapeutic target. PMID: 25962960
  11. During conductance simulation experiments, both TASK-3 and TREK-1 channels were able to repolarise the membrane once AP threshold was reached PMID: 25482670
  12. How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2. PMID: 26332952
  13. We conclude that Trek1 is critical to maintain the nasal epithelial barrier function. PMID: 25778785
  14. Nasal epithelia express Trek1 that can be suppressed by allergic response. PMID: 25529528
  15. Modulation of K2P 2.1 and K2P 10.1 K(+) channel sensitivity to carvedilol by alternative mRNA translation initiation PMID: 25168769
  16. Response of the human detrusor to stretch is regulated by TREK-1 PMID: 24801307
  17. PLD2, but not PLD1, directly binds to the C terminus of TREK1 and TREK2. PMID: 25197053
  18. results suggest that the TREK-1e splice variant may interfere with the vesicular traffic of full-length TREK-1 channels from the ER to the plasma membrane. PMID: 24196565
  19. TREK-1 deficient alveolar epithelial cells have less F-actin and are more deformable making them more resistant to stretch-induced injury. PMID: 24586773
  20. Activation of K(2)P channel-TREK1 mediates the neuroprotection induced by sevoflurane preconditioning. PMID: 24154701
  21. High TREK-1 expression is associated with epithelial ovarian cancer. PMID: 23479219
  22. A number of mutations that affect TREK1 channel gating occlude the action of fenamates but only in the longer form of TREK1. PMID: 24509840
  23. In human embryonic kidney (HEK-293) cells stably expressing TREK-1, outward currents at 80 mV increased from 91.0 +/- 23.8 to 247.5 +/- 73.3 pA/pF. PMID: 23804201
  24. study analyzed the role of TWIK-related potassium channel-1 (TREK1)in endothelial cells and the blood-brain barrier(BBB); blocking TREK1 increased leukocyte transmigration; TREK1 activation had the opposite effect PMID: 23933981
  25. TASK and TREK-1 are involved in regulation of cell proliferation and in control of resting membrane potentials in endometrial epithelial cells. PMID: 23305490
  26. we report the expression of Trek-1 in human alveolar epithelial cells and propose that Trek-1 deficiency may alter both IL-6 translation and transcription in AECs without affecting Ca(2+) signaling PMID: 23275623
  27. each of four TREK-1 splice variants interacts with full-length wild-type TREK-1 and in vivo, such interactions may contribute to a preterm labor phenotype. PMID: 22811574
  28. TREK-1 is expressed by both nucleus pulposus and annulus fibrosus cells of the human intervertebral disc. PMID: 22563662
  29. Cochlin interacts with TREK-1 and annexin A2. PMID: 21886777
  30. the important role of selectivity filter gating in the regulation of TREK-1 by the extracellular K(+) and proton. PMID: 21965685
  31. These results demonstrate that the primary activation mechanisms in TREK-1 reside close to, or within the selectivity filter and do not involve gating at the cytoplasmic bundle crossing. PMID: 21822218
  32. The data of this study suggested that TREK-1 is associated with NSC proliferation and probably is a modulator of the effect that fluoxetine attenuates the inhibitory neurogenesis induced by glucocorticoid hormones. PMID: 21069514
  33. inhibition of TREK1 current by fluoxetine is found to be accompanied by dissociation of the C-terminal domain from the membrane. PMID: 21262820
  34. role for TREK-1 in contributing to uterine quiescence during gestation PMID: 20811500
  35. these data suggest that beta-COP plays a critical role in the forward transport of TREK1 channel to the plasma membrane. PMID: 20362547
  36. Results describe the regulation of neuronal K(2P)2.1 (KCNK2, TREK-1) channel activity by resting membrane potential. PMID: 19837167
  37. These findings indicate that TREK1 genotypes are associated with individual differences in reward-related brain activity. PMID: 19621370
  38. TREK-1 channels may function as sensors that couple the metabolic state of the cell to membrane potential, perhaps through an associated ATP-binding protein PMID: 12368289
  39. During hypoxia, modulation of hTREK1 cannot be accomplished by parameters known to be perturbed in brain ischemia. hTREK1 regulation in brain will be more relevant during alkalosis than during ischemia or acidosis. PMID: 14522822
  40. TREK-1 is inhibited by fluoxetine and norfluoxetine. PMID: 15685212
  41. hypoxic inhibition: (a) requires the C-terminal domain of the channel; (b) does not involve redox modulation of the C-terminal domain cysteine residues C365 and C399; and (c) is critically dependent on the glutamate residue at position 306 PMID: 15883010
  42. receptor- and kinase-induced inhibition of TREK-1 background potassium channels is mediated by sequential phosphorylation PMID: 16006563
  43. human osteoblasts functionally express TREK-1 and that these channels contribute, at least in part, to the resting membrane potential of human osteoblast cells. We hypothesise a possible role for TREK-1 in mechanotransduction, leading to bone remodelling. PMID: 16250016
  44. VOCCs and TREK channels have been implicated in mechanotransduction signaling pathways in numerous connective tissue cell types. PMID: 17035301
  45. TREK1, the most thoroughly studied K(2P) channel, has a key role in the cellular mechanisms of neuroprotection, anaesthesia, pain and depression--{REVIEW} PMID: 17375039
  46. These findings indicate that genetic variation in KCNK2 may identify individuals at risk for treatment resistance. More broadly, they indicate the utility of animal models in identifying genes for pharmacogenetic studies of antidepressant response. PMID: 18288090
  47. voltage-dependent C-type gating acceleration by protons represents a novel mechanism for K2P2.1 outward rectification. PMID: 18474599
  48. (Review) KCNK2, the gene encoding K2P2.1, can generate either full-length or K2P2.1D1-56 via alternative translation initiation, a mechanism which increases protein diversity by giving rise to two or more proteins from a single mRNA strand. PMID: 18579071
  49. Both TASK-3 and TREK-1 are functionally operational in the adrenocortical H295R cell line, modulate membrane potential and aldosterone secretion. PMID: 18854423
  50. Results highlight the important role of K(2P)2.1 channels as receptors for mediators known to cause nociception. PMID: 19130888

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cell membrane; Multi-pass membrane protein.; [Isoform 4]: Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity
Isoform 4 is detected in kidney, adrenal gland and brain where it is preferentially expressed in the amygdala but not found in thalamus, hypothalamus, hippocampus or substantia nigra.
Database Links

HGNC: 6277

OMIM: 603219

KEGG: hsa:3776

STRING: 9606.ENSP00000394033

UniGene: Hs.497745

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*