Recombinant Human Potassium channel subfamily K member 2(KCNK2)

Code CSB-CF012070HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O95069
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA VIENIK
Source in vitro E.coli expression system
Gene Names KCNK2
Protein Names Recommended name: Potassium channel subfamily K member 2 Alternative name(s): Outward rectifying potassium channel protein TREK-1 TREK-1 K(+) channel subunit Two pore domain potassium channel TREK-1 Two pore potassium channel TPKC1
Expression Region 1-426
Tag Info 10xHis-SUMO-tag
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ion channel that contributes to passive transmembrane potassium transport
Subcellular Location Isoform 1: Cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform 4: Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Isoform 4 is detected in kidney, adrenal gland and brain where it is preferentially expressed in the amygdala but not found in thalamus, hypothalamus, hippocampus or substantia nigra.
Database Links

HGNC: 6277

OMIM: 603219

KEGG: hsa:3776

STRING: 9606.ENSP00000394033

UniGene: Hs.497745

Related Products

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.