Name: Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial
Brand: CUSABIO
SKU: CSB-EP002343HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ATP4B

Uniprot No.

P51164

Alternative Names

Gastric H(+)/K(+) ATPase subunit beta; ATP4B; ATP4B_HUMAN; ATP6B; ATPase H+/K+ exchanging beta polypeptide; ATPase H+/K+ transporting beta polypeptide; Gastric H K ATPase catalytic subunit; Gastric H(+)/K(+) ATPase subunit beta; Gastric H+/K+ ATPase beta subunit; Gastric hydrogen potassium ATPase; Gastric hydrogen potassium ATPase beta; Hydrogen/potassium exchanging ATPase 4B; OTTHUMP00000178856; Parietal cell antigen; Potassium transporting ATPase beta chain; Potassium transporting ATPase subunit beta; Potassium-transporting ATPase subunit beta; Proton pump; Proton pump beta chain

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

58-291

Target Protein Sequence

CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

53.6kDa

Protein Length

partial

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

The protein of csb-ep002343hu is n-terminal gst-tag, but I want his tag. There is no corresponding information in the catalog that I have now. If not, how much does it cost to make the protein of his-tag?

Thanks for your inquiry. The gst-tagged protein is a semi-customized protein, and the product details and shelf life are as follows:
Code: CSB-EP002343HUa0
Name: Recombinant Human Potassium-transporting ATPase subunit beta(ATP4B),Partial
Expression System: E.coli
Expression Region: 58-291aa; Partial; Complete extracellular domain
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

Target Background

Function

The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle.

Gene References into Functions

these findings demonstrated that a decrease in pHi, caused by H+/K+-ATPase inhibition induced by BMT-1, triggered the dysfunction of the mitochondria resulting in the apoptosis of MM cells PMID: 24700195
Downregulation of ATP4B gene is associated with gastric cancer. PMID: 23317218
BCL-2 inhibits formation of reactive oxygen species. PMID: 11865975
Content of the beta1 subunit of sodium potassium pump in resistance trained control subjects was 33% higher in trained compared to untrained leg, and 47% higher in trained compared to untrained leg in diabetics. PMID: 14685860
Thus prolonged exhaustive exercise impaired each of the maximal in vitro Na+-K+-ATPase activity, Ca2+ release, and Ca2+ uptake rates. PMID: 15155714
Use of fold recognition methods enables the prediction that a C-terminal domain of the beta subunits of Na,K-ATPase and H,K-ATPase has an immunoglobulin-like fold, which resembles cell adhesion molecules. PMID: 19694409

Hide All

Subcellular Location

Apical cell membrane; Single-pass type II membrane protein. Cell membrane; Single-pass type II membrane protein.

Protein Families

X(+)/potassium ATPases subunit beta family

Database Links

HGNC: 820

OMIM: 137217

KEGG: hsa:496

STRING: 9606.ENSP00000334216

UniGene: Hs.434202

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address